Q9NNX6 identified as C-type lectin in LectomeXplore
Q9NNX6
Redundant proteins identified: B2R907 BAG36354.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: KKAKKEKSELKKVAALEKKLEELKKEVEKLKS-CPKKWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-QLSKSNSY-WIGLTDEKTEGTWQWVDGSPLNY---KNWAPGEPNNAGNEDCVEIKANGWNDVKCEKKKLAICEKEAASCSKEEESVESIENYTCKCDP
PREDICTED: KAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPP
View sequence for C-type lectin 223 : 403View gene sequenceView neighboring sequences
Cite How to cite