Q9Y264 identified as Ficolin-like in LectomeXplore
Q9Y264
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: RSCKDLLDEGSALSGLYTLL--PDGRALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSAEGEFWLGNDKIHALTAQGSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFVGSAGD-SLSLHSNKQFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--GLYLEGSHESYAD-GIDWSSAKGYSYSKKVSEMKVRP
PREDICTED: QDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRP
View sequence for Ficolin-like 289 : 500View gene sequenceView neighboring sequences
Cite How to cite