O43827 identified as Ficolin-like in LectomeXplore
O43827
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: SCKDLLDEGSALSGLYTLLPDGRA----LQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSAEGEFWLGNDKIHALTAQGSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFVGSAG-DSLSLHSNKQFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--G-LYLEGSHESYADGIDWSSAKGYSYSKKVSEMKVRP
PREDICTED: DCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQP-TRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRP
View sequence for Ficolin-like 130 : 341View gene sequenceView neighboring sequences
Cite How to cite