Q8NI99 identified as Ficolin-like in LectomeXplore
Q8NI99
Redundant proteins identified: A0A024R7A9 AAK06404.1 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
REFERENCE: P-RSCKDLLDEGSALSGLYTLLPDGRALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSAEGEFWLGNDKIHALTAQGSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFVGSAGDSLSLHSNKQFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--GLYLEGSH--ESYADGIDWSSAKGYSYSKKVSEMKVRP
PREDICTED: PWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRP
View sequence for Ficolin-like 256 : 467View gene sequenceView neighboring sequences
Cite How to cite