NCBI Summary
This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_065207)
CBM13-ppGalNAc-T1
Polypeptide N-acetylgalactosaminyltransferase 1 (EC 2.4.1.41) (Polypeptide GalNAc transferase 1) (GalNAc-T1) (pp-GaNTase 1) (Protein-UDP acetylgalactosaminyltransferase 1) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 1 soluble form]
GALNT1
polypeptide N-acetylgalactosaminyltransferase 1
Undefined
Curated
Ricin-like
R-Type Lectins
b-trefoil
GalNAc / Mucin-type glycopeptide
0.256
Protein sequence and protein families (fasta) (559 amino acids) Download
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [0.28, 0.77] ÅDownload
The location of the lectin domain structural model is: 429-551
We infer [0.28, 0.77] Å as the interval of error of this structural model.
Template: 1XHB chain: A, O08912, NP_001153876.1, sequence identity: 99.2%, coverage: 100.0%, location in sequence: 95-553, (95-553 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • High Expression of N-Acetylgalactosaminyl-transferase 1 (GALNT1) Associated with Invasion, Metastasis, and Proliferation in Osteosarcoma. [33284788]
  • LAMTOR5 raises abnormal initiation of O-glycosylation in breast cancer metastasis via modulating GALNT1 activity. [31836847]
  • Site-specific glycosylation of Ebola virus glycoprotein by human polypeptide GalNAc-transferase 1 induces cell adhesion defects. [30389789]
  • LncRNA SNHG7 sponges miR-216b to promote proliferation and liver metastasis of colorectal cancer through upregulating GALNT1. [29915311]
  • MiR30-GALNT1/2 Axis-Mediated Glycosylation Contributes to the Increased Secretion of Inactive Human Prohormone for Brain Natriuretic Peptide (proBNP) From Failing Hearts. [28188250]
  • cDNA cloning and expression of a novel human UDP-N-acetyl-alpha-D-galactosamine. Polypeptide N-acetylgalactosaminyltransferase, GalNAc-t3. [8663203]
  • Organization of a human UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase gene and a related processed pseudogene. [8727794]
  • Purification and cDNA cloning of a human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase. [7592619]
  • cDNA cloning, expression, and chromosomal localization of a human UDP-GalNAc:polypeptide, N-acetylgalactosaminyltransferase. [8690719]
  • Glycosyltransferases. Structure, localization, and control of cell type-specific glycosylation. [2681181]
UniProt Main References (4 PubMed Identifiers)
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Substrate specificities of three members of the human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase family, GalNAc-T1, -T2, and -T3. [9295285]
  • Localization of three human polypeptide GalNAc-transferases in HeLa cells suggests initiation of O-linked glycosylation throughout the Golgi apparatus. [9394011]
  • Initial characterization of the human central proteome. [21269460]
All isoforms of this gene containing a lectin domain
NP_001371367.1, NP_001371368.1, NP_001371369.1, NP_001371370.1, NP_001371371.1, NP_001371372.1, NP_001371373.1, NP_001371374.1, NP_001371375.1, NP_065207.2
RNA
RNA (Transcript ID: NM_020474.4)
polypeptide N-acetylgalactosaminyltransferase 1, transcript variant 1
m7G-5')ppp(5'-AGUGGCCGAGGAGCGCGCGGCGGACGGCGGCCCGAGAGUAGCGCGCUGGCCGCGGGACCGGCCGCGACCGCCGCGGCCGGCCCGGAGGACGCCUGCCGCCGCCGCCGCCGCGCGCCUAGCGAGGGUAUGAACGUGAUUUCUGAUGAAACUGGAUUGGAAUAAUUUUCAUGAUCUUUGUAUAUUUAUAUAUAUAUAUUUUUAAAUUUUGCAUUUGACUUAAAGUGCCAUGAGAAAAUUUGCAUACUGCAAGGUGGUCCUAGCCACCUCCUUGAUUUGGGUACUCUUGGAUAUGUUCCUGCUGCUUUACUUCAGUGAAUGCAACAAAUGUGAUGAAAAAAAGGAGAGAGGACUUCCUGCUGGAGAUGUUCUAGAGCCAGUACAAAAGCCUCAUGAAGGUCCUGGAGAAAUGGGGAAACCAGUCGUCAUUCCUAAAGAGGAUCAAGAAAAGAUGAAAGAGAUGUUUAAAAUCAAUCAGUUCAAUUUAAUGGCAAGUGAGAUGAUUGCACUCAACAGAUCUUUACCAGAUGUUAGGUUAGAAGGGUGUAAAACAAAGGUGUAUCCAGAUAAUCUUCCUACAACAAGUGUGGUGAUUGUUUUCCACAAUGAGGCUUGGAGCACACUUCUGCGAACUGUCCAUAGUGUCAUUAAUCGCUCACCAAGACACAUGAUAGAAGAAAUUGUUCUAGUAGAUGAUGCCAGUGAAAGAGACUUUUUGAAAAGGCCUUUAGAGAGUUAUGUGAAAAAACUAAAAGUACCAGUUCAUGUAAUUCGAAUGGAACAACGUUCUGGAUUGAUCAGAGCUAGAUUAAAAGGAGCUGCUGUGUCUAAAGGCCAAGUGAUCACCUUCCUGGAUGCCCAUUGUGAGUGUACAGUGGGAUGGCUGGAGCCUCUCUUGGCCAGGAUCAAACAUGACAGGAGAACAGUGGUGUGUCCCAUCAUCGAUGUGAUCAGUGAUGAUACUUUUGAGUACAUGGCAGGCUCUGAUAUGACCUAUGGUGGGUUCAACUGGAAGCUCAAUUUUCGCUGGUAUCCUGUUCCCCAAAGAGAAAUGGACAGAAGGAAAGGUGAUCGGACUCUUCCUGUCAGGACACCUACCAUGGCAGGAGGCCUUUUUUCAAUAGACAGAGAUUACUUUCAGGAAAUUGGAACAUAUGAUGCUGGAAUGGAUAUUUGGGGAGGAGAAAACCUAGAAAUUUCCUUUAGGAUUUGGCAGUGUGGAGGAACUUUGGAAAUUGUUACAUGCUCACAUGUUGGACAUGUGUUUCGGAAAGCUACACCUUACACGUUUCCAGGAGGCACAGGGCAGAUUAUCAAUAAAAAUAACAGACGACUUGCAGAAGUGUGGAUGGAUGAAUUCAAGAAUUUCUUCUAUAUAAUUUCUCCAGGUGUUACAAAGGUAGAUUAUGGAGAUAUAUCGUCAAGAGUUGGUCUAAGACACAAACUACAAUGCAAACCUUUUUCCUGGUACCUAGAGAAUAUAUAUCCUGAUUCUCAAAUUCCACGUCACUAUUUCUCAUUGGGAGAGAUACGAAAUGUGGAAACGAAUCAGUGUCUAGAUAACAUGGCUAGAAAAGAGAAUGAAAAAGUUGGAAUUUUUAAUUGCCAUGGUAUGGGGGGUAAUCAGGUUUUCUCUUAUACUGCCAACAAAGAAAUUAGAACAGAUGACCUUUGCUUGGAUGUUUCCAAACUUAAUGGCCCAGUUACAAUGCUCAAAUGCCACCACCUAAAAGGCAACCAACUCUGGGAGUAUGACCCAGUGAAAUUAACCCUGCAGCAUGUGAACAGUAAUCAGUGCCUGGAUAAAGCCACAGAAGAGGAUAGCCAGGUGCCCAGCAUUAGAGACUGCAAUGGAAGUCGGUCCCAGCAGUGGCUUCUUCGAAACGUCACCCUGCCAGAAAUAUUCUGAGACCAAAUUUACAAAAAAACGAAAAAAAUAAGGAUUGACUGGGCUACCUCAGCAUACAUUUCUGCCACAUUCUUAAGUAGCAAAAAAGGAAAAGUGCUUUCCUCCUCUGCAGGAUGUAAGGUUUAUCAGCCAUUAAAACUUAGACUUCUCUAGCUUUUCACUAGCUGUGAACCAGCCUUCCUGUCCAUGGACGUGAAACUGCAUAGUAAUGAGACUGUGCACACUGAUGUUUACAAGAUUGAAAGAGUCUUUCUCCGAAAAUCAUGGUAAAGAAUACUGAGACAAUGAAAAAAAAUCAACAAAAUAUGCUUUCUGGAGAACUGUACCUUUUAUGGUUUGCUUGCACAUCAGUAGUUUCUGCUGAACGUGCUGUCAUAAUGAAGAGAUUUCCAAGAUUUUUUUUCCUGAUUAGAACUGGUAGCCAGUAUAUUAAAUAUUGAUAUAAAAAUAAAAGAACUGGAACCAGAUUCAGAAUCAUGAAAACAACAUUUUUACAACAACAAAAAAACUAUAUUAAACAGGGUUUAAAGGAAAUUAAAACAGAACUAUGAGAAGUACAAUUUGUUAUAGUAUAGUAUCAAAUUUCUAUAUAGAUUUUAUACCUCAGUGGGGAAAAAUAACUGAUUCCAAUGACAUUCAUUUUGUUUUCAUCUGUGAUAGUCAUGGAUGCUUUUAUUUUCCUUGGGGUGCUGAAAUUGAGCUGAAAAAAAAAGGCUCUUUGAAUAUAGUUUUAAUUUCUCUCUACAGUUUUUUUUGUUUGGUUUGUGGGCUGUUGGAAUUGUAAUUUUUAAUUGCCUUCUAAAAAAUGGAAAUUUAACAAUGUCUGAUCUCAGCUGAACAAAUUAGAUGUUUCAGUUGCUCUUGGGUCAACUGGCUUACAGAUUUACAUGUGCACACACACACAAAUUUCUUAUCACAUUUUCGACUUCUUCACUUGACCUAACUGAUUAUGCGAAAUACCCAAGAUUCAUGCUACUGUACCACAGAUUUGUUUUCACAGCAAUAAAUCUUCAGUUCUUUGUUUAUGAUUCCACUUAACAAAAGGCCUGCAGAAGUGAUUUAUUAUUUGGGUAUUUGGAGAUAAUACAUUUGAUGGUUUUUUGGAAAACCUUUUUCACUCCAUACUCAGAUAUGCUUCAUUGUCAAAUGCAUAUUUAGAUUAGAUUAUUGAAUUGUAAUGUUUAUCUGCUGCUUUUUUUAAAUAAAAUUUGACUGAAAAUGUUUAAUUGGCAUUUUUUAAUGACUUAGCCAAAGAAGUGCAGCUAUUAUUCCAUAUUAAUAGGCUUGCAUUUCUUUUCCUAAAUCUUAUUUAGGCUAAAUCAGUUUUAUUUUUCUCUGAUUUUUUUUAAUACCACAGAAUCACCUGAGUGUCAAUUGAAAGUUGUCAAUUAAAAGGUAACCUUUUAAUCUCGUAGGAGGAAUCUCAUUAAGACAUUUUUCCUGAUAUGUAGAGCAGUCUGUUGGCAAAAAUGCAUAUAUUUUCUUUCAUAUUUGUAAAAUUAUAUUUAAUGGAAUUCUUUUCUUUGAUUAUCAAGGACUUUCACUGCAGGCAGUGCUAUUUCUUGUGCCUAAGAAUGUUUCCAAAAGUCGCAUCGCUAAUGAUAUUUGCCAAGUUGAGUGUACACAAAGUUUCUCAUAUCCUGUUCAAGUUAAUCAACAUCAAGCACAUGGGGAUGCUUUAGGGUGAGUCUAUAGUACAAAAUGCAUAAACCAUGUCCCCAGGAAAUUUGAAAGGAAGCAGGUGCUGAAUGGAAUUUUUUUCCUUUUCCAUGAGCUGUGUUAAUUCUAUCUCCAGUAGGCCUAAUGCUUGAAUAAGCAAGAUGUCUAAUCAAUAAAUUAUUUUCAUGCUCAGAAUUUCAGGUUUUUGUACUCCAGCAUAGCUUGGUCUUAUUUCUUACUGUAUGAAAGCUUAACAGCAAUGUGAUUUAAGGUUUUGUUUUAAAUGGGAGAUGUAAGUGAUUUAAUUCAUGGGUACUUUUAGAACCUGAUAGAUAAUCCCAUUGCCUUUAUUUUUCUAAUUAAAGAAUUCCUAAAUACUUUGAAAAUACAAAAUAUUCCUGAAUA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 2589)
polypeptide N-acetylgalactosaminyltransferase 1
strand +
GalNAc-T1
NCBI CDS gene sequence (1680 bp)
5'-ATGAGAAAATTTGCATACTGCAAGGTGGTCCTAGCCACCTCCTTGATTTGGGTACTCTTGGATATGTTCCTGCTGCTTTACTTCAGTGAATGCAACAAATGTGATGAAAAAAAGGAGAGAGGACTTCCTGCTGGAGATGTTCTAGAGCCAGTACAAAAGCCTCATGAAGGTCCTGGAGAAATGGGGAAACCAGTCGTCATTCCTAAAGAGGATCAAGAAAAGATGAAAGAGATGTTTAAAATCAATCAGTTCAATTTAATGGCAAGTGAGATGATTGCACTCAACAGATCTTTACCAGATGTTAGGTTAGAAGGGTGTAAAACAAAGGTGTATCCAGATAATCTTCCTACAACAAGTGTGGTGATTGTTTTCCACAATGAGGCTTGGAGCACACTTCTGCGAACTGTCCATAGTGTCATTAATCGCTCACCAAGACACATGATAGAAGAAATTGTTCTAGTAGATGATGCCAGTGAAAGAGACTTTTTGAAAAGGCCTTTAGAGAGTTATGTGAAAAAACTAAAAGTACCAGTTCATGTAATTCGAATGGAACAACGTTCTGGATTGATCAGAGCTAGATTAAAAGGAGCTGCTGTGTCTAAAGGCCAAGTGATCACCTTCCTGGATGCCCATTGTGAGTGTACAGTGGGATGGCTGGAGCCTCTCTTGGCCAGGATCAAACATGACAGGAGAACAGTGGTGTGTCCCATCATCGATGTGATCAGTGATGATACTTTTGAGTACATGGCAGGCTCTGATATGACCTATGGTGGGTTCAACTGGAAGCTCAATTTTCGCTGGTATCCTGTTCCCCAAAGAGAAATGGACAGAAGGAAAGGTGATCGGACTCTTCCTGTCAGGACACCTACCATGGCAGGAGGCCTTTTTTCAATAGACAGAGATTACTTTCAGGAAATTGGAACATATGATGCTGGAATGGATATTTGGGGAGGAGAAAACCTAGAAATTTCCTTTAGGATTTGGCAGTGTGGAGGAACTTTGGAAATTGTTACATGCTCACATGTTGGACATGTGTTTCGGAAAGCTACACCTTACACGTTTCCAGGAGGCACAGGGCAGATTATCAATAAAAATAACAGACGACTTGCAGAAGTGTGGATGGATGAATTCAAGAATTTCTTCTATATAATTTCTCCAGGTGTTACAAAGGTAGATTATGGAGATATATCGTCAAGAGTTGGTCTAAGACACAAACTACAATGCAAACCTTTTTCCTGGTACCTAGAGAATATATATCCTGATTCTCAAATTCCACGTCACTATTTCTCATTGGGAGAGATACGAAATGTGGAAACGAATCAGTGTCTAGATAACATGGCTAGAAAAGAGAATGAAAAAGTTGGAATTTTTAATTGCCATGGTATGGGGGGTAATCAGGTTTTCTCTTATACTGCCAACAAAGAAATTAGAACAGATGACCTTTGCTTGGATGTTTCCAAACTTAATGGCCCAGTTACAATGCTCAAATGCCACCACCTAAAAGGCAACCAACTCTGGGAGTATGACCCAGTGAAATTAACCCTGCAGCATGTGAACAGTAATCAGTGCCTGGATAAAGCCACAGAAGAGGATAGCCAGGTGCCCAGCATTAGAGACTGCAATGGAAGTCGGTCCCAGCAGTGGCTTCTTCGAAACGTCACCCTGCCAGAAATATTCTGA-3'
NCBI CDS gene sequence with introns (location: 35654663.. 35709770) (55108 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 35581740.. 35711834) (130095 bp)Download
NCBI gene sequence (location: [35581740 - 1000].. 35711834) (131095 bp)Download
Cite How to cite