NCBI Summary
This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_064514)
Galectin 14
Placental protein 13-like (Charcot-Leyden crystal protein 2) (CLC2) (Galectin-14) (Gal-14)
LGALS14
galectin 14
Undefined
Low evidence
Galectin
S-Type Lectins - Prototypical
b-sandwich / ConA-like
0.394
Protein sequence and protein families (fasta) (139 amino acids) Download
MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
bGal14Glc
Gal(b1-4)Glc
References
NCBI References (10 PubMed Identifiers)
  • Structure-function studies of galectin-14, an important effector molecule in embryology. [32525264]
  • Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
  • A reference map of the human binary protein interactome. [32296183]
  • Extensive disruption of protein interactions by genetic variants across the allele frequency spectrum in human populations. [31515488]
  • Pooled-matrix protein interaction screens using Barcode Fusion Genetics. [27107012]
  • A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. [19497882]
  • Gene variants associated with ischemic stroke: the cardiovascular health study. [19023099]
  • Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study. [17975119]
  • [siRNA-mediated silencing of ClC-2 gene inhibits proliferation of human U-87 glioma cells]. [16831268]
  • Cloning and expression of a novel human galectin cDNA, predominantly expressed in placenta(1). [11997112]
UniProt Main References (3 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and biology of human chromosome 19. [15057824]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
All isoforms of this gene containing a lectin domain
NP_064514.1, NP_982297.1
RNA
RNA (Transcript ID: NM_020129.3)
galectin 14, transcript variant 1
m7G-5')ppp(5'-ACAGAAGACUGGACACAAUUCCGAAGAGCUGCCCAGAAGGAGAGAACAAUGUCAUCACUACCCGUACCAUACACACUGCCUGUUUCCUUGCCUGUUGGUUCGUGCGUGAUAAUCACAGGGACACCGAUCCUCACUUUUGUCAAGGACCCACAGCUGGAGGUGAAUUUCUACACUGGGAUGGAUGAGGACUCAGAUAUUGCUUUCCAAUUCCGACUGCACUUUGGUCAUCCUGCAAUCAUGAACAGUUGUGUGUUUGGCAUAUGGAGAUAUGAGGAGAAAUGCUACUAUUUACCCUUUGAAGAUGGCAAACCAUUUGAGCUGUGCAUCUAUGUGCGUCACAAGGAAUACAAGGUAAUGGUAAAUGGCCAACGCAUUUACAACUUUGCCCAUCGAUUCCCGCCAGCAUCUGUGAAGAUGCUGCAAGUCUUCAGAGAUAUCUCCCUGACCAGAGUGCUUAUCAGCGAUUGAGGGAGAUGAUCAGACUCCUCAUUGUUGAGGAAUCCCUCUUUCUACCUGACCAUGGGAUUCCCAGAGCCUACUAACAGAAUAAUCCCUCCUCACCCCUUCCCCUACACUUGAUCAUUAAAACAGCACCAAAC-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 56891)
galectin 14
strand +
PPL13, CLC2
NCBI CDS gene sequence (420 bp)
5'-ATGTCATCACTACCCGTACCATACACACTGCCTGTTTCCTTGCCTGTTGGTTCGTGCGTGATAATCACAGGGACACCGATCCTCACTTTTGTCAAGGACCCACAGCTGGAGGTGAATTTCTACACTGGGATGGATGAGGACTCAGATATTGCTTTCCAATTCCGACTGCACTTTGGTCATCCTGCAATCATGAACAGTTGTGTGTTTGGCATATGGAGATATGAGGAGAAATGCTACTATTTACCCTTTGAAGATGGCAAACCATTTGAGCTGTGCATCTATGTGCGTCACAAGGAATACAAGGTAATGGTAAATGGCCAACGCATTTACAACTTTGCCCATCGATTCCCGCCAGCATCTGTGAAGATGCTGCAAGTCTTCAGAGATATCTCCCTGACCAGAGTGCTTATCAGCGATTGA-3'
NCBI CDS gene sequence with introns (location: 39704529.. 39709313) (4785 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 39704481.. 39709444) (4964 bp)Download
NCBI gene sequence (location: [39704481 - 1000].. 39709444) (5964 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905