NCBI Summary
This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_064514)
Galectin 14
Placental protein 13-like (Charcot-Leyden crystal protein 2) (CLC2) (Galectin-14) (Gal-14)
LGALS14
galectin 14
Undefined
Low evidence
Galectin
S-Type Lectins - Prototypical
b-sandwich / ConA-like
MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
Mol* PDB structure viewerUniLectin3D
Structural models
References
NCBI References (10 PubMed Identifiers)
- Structure-function studies of galectin-14, an important effector molecule in embryology. [32525264]
- Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
- A reference map of the human binary protein interactome. [32296183]
- Extensive disruption of protein interactions by genetic variants across the allele frequency spectrum in human populations. [31515488]
- Pooled-matrix protein interaction screens using Barcode Fusion Genetics. [27107012]
- A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. [19497882]
- Gene variants associated with ischemic stroke: the cardiovascular health study. [19023099]
- Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study. [17975119]
- [siRNA-mediated silencing of ClC-2 gene inhibits proliferation of human U-87 glioma cells]. [16831268]
- Cloning and expression of a novel human galectin cDNA, predominantly expressed in placenta(1). [11997112]
UniProt Main References (3 PubMed Identifiers)
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- The DNA sequence and biology of human chromosome 19. [15057824]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_020129.3)
m7G-5')ppp(5'-ACAGAAGACUGGACACAAUUCCGAAGAGCUGCCCAGAAGGAGAGAACAAUGUCAUCACUACCCGUACCAUACACACUGCCUGUUUCCUUGCCUGUUGGUUCGUGCGUGAUAAUCACAGGGACACCGAUCCUCACUUUUGUCAAGGACCCACAGCUGGAGGUGAAUUUCUACACUGGGAUGGAUGAGGACUCAGAUAUUGCUUUCCAAUUCCGACUGCACUUUGGUCAUCCUGCAAUCAUGAACAGUUGUGUGUUUGGCAUAUGGAGAUAUGAGGAGAAAUGCUACUAUUUACCCUUUGAAGAUGGCAAACCAUUUGAGCUGUGCAUCUAUGUGCGUCACAAGGAAUACAAGGUAAUGGUAAAUGGCCAACGCAUUUACAACUUUGCCCAUCGAUUCCCGCCAGCAUCUGUGAAGAUGCUGCAAGUCUUCAGAGAUAUCUCCCUGACCAGAGUGCUUAUCAGCGAUUGAGGGAGAUGAUCAGACUCCUCAUUGUUGAGGAAUCCCUCUUUCUACCUGACCAUGGGAUUCCCAGAGCCUACUAACAGAAUAAUCCCUCCUCACCCCUUCCCCUACACUUGAUCAUUAAAACAGCACCAAAC-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 56891)
galectin 14
strand +
PPL13, CLC2
NCBI CDS gene sequence (420 bp)
5'-ATGTCATCACTACCCGTACCATACACACTGCCTGTTTCCTTGCCTGTTGGTTCGTGCGTGATAATCACAGGGACACCGATCCTCACTTTTGTCAAGGACCCACAGCTGGAGGTGAATTTCTACACTGGGATGGATGAGGACTCAGATATTGCTTTCCAATTCCGACTGCACTTTGGTCATCCTGCAATCATGAACAGTTGTGTGTTTGGCATATGGAGATATGAGGAGAAATGCTACTATTTACCCTTTGAAGATGGCAAACCATTTGAGCTGTGCATCTATGTGCGTCACAAGGAATACAAGGTAATGGTAAATGGCCAACGCATTTACAACTTTGCCCATCGATTCCCGCCAGCATCTGTGAAGATGCTGCAAGTCTTCAGAGATATCTCCCTGACCAGAGTGCTTATCAGCGATTGA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.