NCBI Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded protein may play a role in regulating dendritic cell function. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014].
Protein
Protein (NP_057595)
C-type lectin domain family 1 member A
C-type lectin domain family 1 member A (C-type lectin-like receptor 1) (CLEC-1)
CLEC1A
C-type lectin domain family 1 member A
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
Uncharacterised
0.312
Undefined
Protein sequence and protein families (fasta) (280 amino acids) Download
MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.58, 2.05] ÅDownload
The location of the lectin domain structural model is: 125-265
We infer [1.58, 2.05] Å as the interval of error of this structural model.
Template 1: 2BPE chain: A, Q6QLQ4, NP_0NO0REFSEQ0.0, sequence identity: 26.2%, coverage: 90.1%, location in sequence: 117-244, (117-244 in PDB).
Template 2: 6JJJ chain: A, P70194, NP_058031.2, sequence identity: 23.4%, coverage: 96.5%, location in sequence: 393-543, (393-543 in PDB).
Template 3: 3ZHG chain: A, Q8CJ91, NP_081248.4, sequence identity: 22.7%, coverage: 92.2%, location in sequence: 191-322, (191-322 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (9 PubMed Identifiers)
  • CLEC-1 Acts as a Negative Regulator of Dectin-1 Induced Host Inflammatory Response Signature in Aspergillus fumigatus Keratitis. [34043748]
  • Histidine-Rich Glycoprotein Stimulates Human Neutrophil Phagocytosis and Prolongs Survival through CLEC1A. [33452125]
  • A reference map of the human binary protein interactome. [32296183]
  • The human C-type lectin-like receptor CLEC-1 is upregulated by TGF-beta and primarily localized in the endoplasmic membrane compartment. [22117783]
  • Dendritic cell immunoreceptors: C-type lectin receptors for pattern-recognition and signaling on antigen-presenting cells. [17046204]
  • Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily. [12945048]
  • A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex. [11745369]
  • Molecular characterization of two novel C-type lectin-like receptors, one of which is selectively expressed in human dendritic cells. [10671229]
  • C-type lectin-like domains. [10508765]
UniProt Main References (3 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
All isoforms of this gene containing a lectin domain
NP_001284678.1, XP_011518989.1, NP_001284679.1, NP_001284680.1, NP_001284677.1, NP_057595.2
RNA
RNA (Transcript ID: NM_016511.4)
C-type lectin domain family 1 member A, transcript variant 1
m7G-5')ppp(5'-ACAGUAGCCCGGCGGCCCAGGGCAAUCCGACCACAUUUCACUCUCACCGCUGUAGGAAUCCAGAUGCAGGCCAAGUACAGCAGCACGAGGGACAUGCUGGAUGAUGAUGGGGACACCACCAUGAGCCUGCAUUCUCAAGGCUCUGCCACAACUCGGCAUCCAGAGCCCCGGCGCACAGAGCACAGGGCUCCCUCUUCAACGUGGCGACCAGUGGCCCUGACCCUGCUGACUUUGUGCUUGGUGCUGCUGAUAGGGCUGGCAGCCCUGGGGCUUUUGUUUUUUCAGUACUACCAGCUCUCCAAUACUGGUCAAGACACCAUUUCUCAAAUGGAAGAAAGAUUAGGAAAUACGUCCCAAGAGUUGCAAUCUCUUCAAGUCCAGAAUAUAAAGCUUGCAGGAAGUCUGCAGCAUGUGGCUGAAAAACUCUGUCGUGAGCUGUAUAACAAAGCUGGAGCACACAGGUGCAGCCCUUGUACAGAACAAUGGAAAUGGCAUGGAGACAAUUGCUACCAGUUCUAUAAAGACAGCAAAAGUUGGGAGGACUGUAAAUAUUUCUGCCUUAGUGAAAACUCUACCAUGCUGAAGAUAAACAAACAAGAAGACCUGGAAUUUGCCGCGUCUCAGAGCUACUCUGAGUUUUUCUACUCUUAUUGGACAGGGCUUUUGCGCCCUGACAGUGGCAAGGCCUGGCUGUGGAUGGAUGGAACCCCUUUCACUUCUGAACUGUUCCAUAUUAUAAUAGAUGUCACCAGCCCAAGAAGCAGAGACUGUGUGGCCAUCCUUAAUGGGAUGAUCUUCUCAAAGGACUGCAAAGAAUUGAAGCGUUGUGUCUGUGAGAGAAGGGCAGGAAUGGUGAAGCCAGAGAGCCUCCAUGUCCCCCCUGAAACAUUAGGCGAAGGUGACUGAUUCGCCCUCUGCAACUACAAAUAGCAGAGUGAGCCAGGCGGUGCCAAAGCAAGGGCUAGUUGAGACAUUGGGAAAUGGAACAUAAUCAGGAAAGACUAUCUCUCUGACUAGUACAAAAUGGGUUCUCGUGUUUCCUGUUCAGGAUCACCAGCAUUUCUGAGCUUGGGUUUAUGCACGUAUUUAACAGUCACAAGAAGUCUUAUUUACAUGCCACCAACCAACCUCAGAAACCCAUAAUGUCAUCUGCCUUCUUGGCUUAGAGAUAACUUUUAGCUCUCUUUCUUCUCAAUGUCUAAUAUCACCUCCCUGUUUUCAUGUCUUCCUUACACUUGGUGGAAUAAGAAACUUUUUGAAGUAGAGGAAAUACAUUGAGGUAACAUCCUUUUCUCUGACAGUCAAGUAGUCCAUCAGAAAUUGGCAGUCACUUCCCAGAUUGUACCAGCAAAUACACAAGGAAUUCUUUUUGUUUGUUUCAGUUCAUACUAGUCCCUUCCCAAUCCAUCAGUAAAGACCCCAUCUGCCUUGUCCAUGCCGUUUCCCAACAGGGAUGUCACUUGAUAUGAGAAUCUCAAAUCUCAAUGCCUUAUAAGCAUUCCUUCCUGUGUCCAUUAAGACUCUGAUAAUUGUCUCCCCUCCAUAGGAAUUUCUCCCAGGAAAGAAAUAUAUCCCCAUCUCCGUUUCAUAUCAGAACUACCGUCCCCGAUAUUCCCUUCAGAGAGAUUAAAGACCAGAAAAAAGUGAGCCUCUUCAUCUGCACCUGUAAUAGUUUCAGUUCCUAUUUUCUUCCAUUGACCCAUAUUUAUACCUUUCAGGUACUGAAGAUUUAAUAAUAAUAAAUGUAAAUACUGUGAAGUGUGUGUGAUUUUACAAUGGACUUAUGGUUGGUGGGAAAAUUCAGCAUGGAAAUGCUUUUCAAAAUAUGAUAGCGGUCAUUAUUUUGAUUGUGCCUUACUGAAAGUUUUUGGGGAAUUUACAAGAGUACUGAUUACAUGAUUAUCUGGAGAAAAUAAGAUGUCUUUGAAAUACGUGUUGGCUUCAAGAAAACAGUUUUAACGUUUUCCUAAAAUGAAAUCUUUUGAGGUGAGCUUAUGGCAUCAACACAUGGUUGAUGAGGAAGCUGAGUUGCAUUAGUGCACAUGAUUUCCAGUCAGGUCAUGGGAAAUGAACAGAGACAGUGACAUCUUUGUAGCUGCUCCUUUGUGAGGCACUUCUUUCUUGAGACGACUCCAUGCACAAAUAUAACAGGGAUCAUUGGGAAUGACACCAUCACAGCCACCAAGUUUAUUGGUUUACUGAUAAAUCAAUUUUGAGGGUUUUAUGCUAGAAAAGAUAACAUUAUAAAUCUUUGUUUUUCAACAGUGGAAACUGAGGUGCUUCAGUUUUGUUUUUCAUAAACAUCUAUCUCAUGGUAAAAUGACGUAUAGUAGCAAUCAUAUGAUAGAAAGAACACAUUGGUGCUCAUUUUCAUAAACUUCAUUUUGUUAGAUUGUCACUUAGCAAAGACUAUUGCGGAUUCUUCCUUGAGAACUUUCCUUUCAAUUUUCUGUUGAUUUCCUUAAAAUUUUCUUCAGGGUCGAGCAAGUUCUGUUGAUAUAUUGUGUCAUGCAAAGAAAACUGUAUUUGUGGUUAGAAAAUGAAGAUUUUAGACCUCUUAUUCUGAUUUACUUAUUAGGCAAGUCACUUUACUUCAUGAAACCUAUUUCACUGCAUAUGAAGUAGAAAUAAUUAUAAUUUCCUCAUAAUGUUACUGUUAGCUGAAAUAAAGUAAAUGUGAAAUCA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 51267)
C-type lectin domain family 1 member A
strand -
CLEC1, CLEC-1, MGC34328
NCBI CDS gene sequence (843 bp)
5'-ATGCAGGCCAAGTACAGCAGCACGAGGGACATGCTGGATGATGATGGGGACACCACCATGAGCCTGCATTCTCAAGGCTCTGCCACAACTCGGCATCCAGAGCCCCGGCGCACAGAGCACAGGGCTCCCTCTTCAACGTGGCGACCAGTGGCCCTGACCCTGCTGACTTTGTGCTTGGTGCTGCTGATAGGGCTGGCAGCCCTGGGGCTTTTGTTTTTTCAGTACTACCAGCTCTCCAATACTGGTCAAGACACCATTTCTCAAATGGAAGAAAGATTAGGAAATACGTCCCAAGAGTTGCAATCTCTTCAAGTCCAGAATATAAAGCTTGCAGGAAGTCTGCAGCATGTGGCTGAAAAACTCTGTCGTGAGCTGTATAACAAAGCTGGAGCACACAGGTGCAGCCCTTGTACAGAACAATGGAAATGGCATGGAGACAATTGCTACCAGTTCTATAAAGACAGCAAAAGTTGGGAGGACTGTAAATATTTCTGCCTTAGTGAAAACTCTACCATGCTGAAGATAAACAAACAAGAAGACCTGGAATTTGCCGCGTCTCAGAGCTACTCTGAGTTTTTCTACTCTTATTGGACAGGGCTTTTGCGCCCTGACAGTGGCAAGGCCTGGCTGTGGATGGATGGAACCCCTTTCACTTCTGAACTGTTCCATATTATAATAGATGTCACCAGCCCAAGAAGCAGAGACTGTGTGGCCATCCTTAATGGGATGATCTTCTCAAAGGACTGCAAAGAATTGAAGCGTTGTGTCTGTGAGAGAAGGGCAGGAATGGTGAAGCCAGAGAGCCTCCATGTCCCCCCTGAAACATTAGGCGAAGGTGACTGA-3'
NCBI CDS gene sequence with introns (location: 10071333.. 10098922) (27590 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 10069554.. 10098985) (29432 bp)Download
NCBI gene sequence (location: [10069554.. 10098985 + 1000]) (30432 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905