NCBI Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_055173)
Mincle
C-type lectin domain family 4 member E (C-type lectin superfamily member 9) (Macrophage-inducible C-type lectin) (MINCLE)
CLEC4E
C-type lectin domain family 4 member E
Undefined
Curated
C-type lectin
CLEC4E
C-type - Type II transmembrane receptors
a/b mixed / C-type lectin-like
Trehalose / Glycolipid
0.432
Protein sequence and protein families (fasta) (219 amino acids) Download
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Monomer and homodimer (PubMed:18509109). Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex; the interaction is direct (By similarity). Alternatively, acts as a bridge for interaction between CLEC4D and FCER1G. A heterodimer of CLEC4E and CLEC4D associates with FCER1G to form a functional complex (By similarity). Interacts with SAP130 nuclear protein that is released from necrotic cells; the interaction is direct (By similarity). Source: UniProt
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • A case-control study on correlation between the single nucleotide polymorphism of CLEC4E and the susceptibility to tuberculosis among Han people in Western China. [34376176]
  • A reference map of the human binary protein interactome. [32296183]
  • Molecular mechanism of obesity-induced adipose tissue inflammation. the role of Mincle in adipose tissue fibrosis and ectopic lipid accumulation. [31852849]
  • Immune Recognition of Pathogen-Derived Glycolipids Through Mincle. [32152942]
  • Association between CLEC4E gene polymorphism of mincle and pulmonary tuberculosis infection in a northern Chinese population. [31075410]
  • Crosstalk between components of the innate immune system: promoting anti-microbial defenses and avoiding immunopathologies. [19120481]
  • Human and mouse macrophage-inducible C-type lectin (Mincle) bind Candida albicans. [18509109]
  • Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily. [12945048]
  • A novel LPS-inducible C-type lectin is a transcriptional target of NF-IL6 in macrophages. [10528209]
  • C-type lectin-like domains. [10508765]
UniProt Main References (8 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The finished DNA sequence of human chromosome 12. [16541075]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • The macrophage-inducible C-type lectin, mincle, is an essential component of the innate immune response to Candida albicans. [18490740]
  • Mincle is an ITAM-coupled activating receptor that senses damaged cells. [18776906]
  • C-type lectin MCL is an FcRgamma-coupled receptor that mediates the adjuvanticity of mycobacterial cord factor. [23602766]
  • Structural analysis for glycolipid recognition by the C-type lectins Mincle and MCL. [24101491]
All isoforms of this gene containing a lectin domain
XP_011518916.1, NP_055173.1, XP_011518917.1
RNA
RNA (Transcript ID: NM_014358.4)
C-type lectin domain family 4 member E
m7G-5')ppp(5'-AUUCAUUCUCCCUGAAUCUUACCAACAAAACACUCCUGAGGAGAAAGAAAGAGAGGGAGGGAGAGAAAAAGAGAGAGAGAGAAACAAAAAACCAAAGAGAGAGAAAAAAUGAAUUCAUCUAAAUCAUCUGAAACACAAUGCACAGAGAGAGGAUGCUUCUCUUCCCAAAUGUUCUUAUGGACUGUUGCUGGGAUCCCCAUCCUAUUUCUCAGUGCCUGUUUCAUCACCAGAUGUGUUGUGACAUUUCGCAUCUUUCAAACCUGUGAUGAGAAAAAGUUUCAGCUACCUGAGAAUUUCACAGAGCUCUCCUGCUACAAUUAUGGAUCAGGUUCAGUCAAGAAUUGUUGUCCAUUGAACUGGGAAUAUUUUCAAUCCAGCUGCUACUUCUUUUCUACUGACACCAUUUCCUGGGCGUUAAGUUUAAAGAACUGCUCAGCCAUGGGGGCUCACCUGGUGGUUAUCAACUCACAGGAGGAGCAGGAAUUCCUUUCCUACAAGAAACCUAAAAUGAGAGAGUUUUUUAUUGGACUGUCAGACCAGGUUGUCGAGGGUCAGUGGCAAUGGGUGGACGGCACACCUUUGACAAAGUCUCUGAGCUUCUGGGAUGUAGGGGAGCCCAACAACAUAGCUACCCUGGAGGACUGUGCCACCAUGAGAGACUCUUCAAACCCAAGGCAAAAUUGGAAUGAUGUAACCUGUUUCCUCAAUUAUUUUCGGAUUUGUGAAAUGGUAGGAAUAAAUCCUUUGAACAAAGGAAAAUCUCUUUAAGAACAGAAGGCACAACUCAAAUGUGUAAAGAAGGAAGAGCAAGAACAUGGCCACACCCACCGCCCCACACGAGAAAUUUGUGCGCUGAACUUCAAAGGACUUCAUAAGUAUUUGUUACUCUGAUAUAAAUAAAAAUAAGUAGUUUUAAAUGUUAUAAUUCAUGUUACUGGCUGAAGUGCAUUUUCUCUCUACGUUAGUCUCAGGUCCUCUUCCCAGAAUUUACAAAGCAAUUCACUACCUUUUGCUACAUUUGCCUCAUUUUUUAGUGUUCGUAUGAAAGUACAGGGACACGGAGCCAAGACAGAGUCUAGCAAAGAAGGGGAUUUUGGAAGGUGCCUUCCAAAAAUCUCCUGAAUCCGGGCUCUGUAGCAGGUCCUCUUCUUUCUAGCUUCUGACAAGUCUGUCUUCUCUUCUUGGUUUCAUACCGUUCUUAUCUCCUGCCCAAGCAUAUAUCGUCUCUUUACUCCCCUGUAUAAUGAGUAAGAAGCUUCUUCAAGUCAUGAAACUUAUUCCUGCUCAGAAUACCGGUGUGGCCUUUCUGGCUACAGGCCUCCACUGCACCUUCUUAGGGAAGGGCAUGCCAGCCAUCAGCUCCAAACAGGCUGUAACCAAGUCCACCCAUCCCUGGGGCUUCCUUUGCUCUGCCUUAUUUUCAAUUGACUGAAUGGAUCUCACCAGAUUUUGUAUCUAUUGCUCAGCUAGGACCCGAGUCCAAUAGUCAAUUUAUUCUAAGCGAACAUUCAUCUCCACACUUUCCUGUCUCAAGCCCAUCCAUUAUUUCUUAACUUUUAUUUUAGCUUUCGGGGGUACAUGUUAAAGGCUUUUUAUAUAGGUAAACUCAUGUCGUGGAGGUUUGUUGUACAGAUUAUUUCAUCACCCAGGUAUUAAGCCCAGUGCCUAAUAUUGUUUUUUUCGGCUCCUCUCCCUCCUCCUACCUUCCGCCCUCAAGUAGACUCCAGUGUCUGUUAUUCCCUUCUUUGUGUUUAUGAAUUCUCAUCAUUUAGCUCCCACUUAUAAGUGAGGACAUGCAGUAUUUGGUUUUCUGUUCCCAUGUUUGCUAAGGAUAAUGGUCUCCAGUUCUACCGAUGUUCCCACAAAAGACAUAAUCUUCUUUUUUAAGGCUGCUUAGUAUUCCAUGGUAUCUAUGUAUCACAUUUUCUCUAUCCAAUCUAUUGUUGACUCACAUUUAGAUUGAUUCCAUGUUUUUGCUAUUGUGAAUAGUGCUGCAAUGAACAUUCGUGUGCAUGUGUCUUUAUGGUAGAAAGAUUUAUAUUUCUCUGAGUAUGUAUCCAGUAAUAGCCCAUUCAUUUAUUGCAUAAAAUUCUACCAAUAC-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 26253)
C-type lectin domain family 4 member E
strand -
MINCLE
NCBI CDS gene sequence (660 bp)
5'-ATGAATTCATCTAAATCATCTGAAACACAATGCACAGAGAGAGGATGCTTCTCTTCCCAAATGTTCTTATGGACTGTTGCTGGGATCCCCATCCTATTTCTCAGTGCCTGTTTCATCACCAGATGTGTTGTGACATTTCGCATCTTTCAAACCTGTGATGAGAAAAAGTTTCAGCTACCTGAGAATTTCACAGAGCTCTCCTGCTACAATTATGGATCAGGTTCAGTCAAGAATTGTTGTCCATTGAACTGGGAATATTTTCAATCCAGCTGCTACTTCTTTTCTACTGACACCATTTCCTGGGCGTTAAGTTTAAAGAACTGCTCAGCCATGGGGGCTCACCTGGTGGTTATCAACTCACAGGAGGAGCAGGAATTCCTTTCCTACAAGAAACCTAAAATGAGAGAGTTTTTTATTGGACTGTCAGACCAGGTTGTCGAGGGTCAGTGGCAATGGGTGGACGGCACACCTTTGACAAAGTCTCTGAGCTTCTGGGATGTAGGGGAGCCCAACAACATAGCTACCCTGGAGGACTGTGCCACCATGAGAGACTCTTCAAACCCAAGGCAAAATTGGAATGATGTAACCTGTTTCCTCAATTATTTTCGGATTTGTGAAATGGTAGGAATAAATCCTTTGAACAAAGGAAAATCTCTTTAA-3'
NCBI CDS gene sequence with introns (location: 8534638.. 8540797) (6160 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 8533305.. 8540905) (7601 bp)Download
NCBI gene sequence (location: [8533305.. 8540905 + 1000]) (8601 bp)Download
Cite How to cite