NCBI Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_055173)
Mincle
C-type lectin domain family 4 member E (C-type lectin superfamily member 9) (Macrophage-inducible C-type lectin) (MINCLE)
CLEC4E
C-type lectin domain family 4 member E
Undefined
Curated
C-type lectin
CLEC4E
C-type - Type II transmembrane receptors
a/b mixed / C-type lectin-like
Trehalose / Glycolipid
0.432
Protein sequence and protein families (fasta) (219 amino acids) Download
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Monomer and homodimer (PubMed:18509109). Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex; the interaction is direct (By similarity). Alternatively, acts as a bridge for interaction between CLEC4D and FCER1G. A heterodimer of CLEC4E and CLEC4D associates with FCER1G to form a functional complex (By similarity). Interacts with SAP130 nuclear protein that is released from necrotic cells; the interaction is direct (By similarity)
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • A case-control study on correlation between the single nucleotide polymorphism of CLEC4E and the susceptibility to tuberculosis among Han people in Western China. [34376176]
  • A reference map of the human binary protein interactome. [32296183]
  • Molecular mechanism of obesity-induced adipose tissue inflammation. the role of Mincle in adipose tissue fibrosis and ectopic lipid accumulation. [31852849]
  • Immune Recognition of Pathogen-Derived Glycolipids Through Mincle. [32152942]
  • Association between CLEC4E gene polymorphism of mincle and pulmonary tuberculosis infection in a northern Chinese population. [31075410]
  • Crosstalk between components of the innate immune system: promoting anti-microbial defenses and avoiding immunopathologies. [19120481]
  • Human and mouse macrophage-inducible C-type lectin (Mincle) bind Candida albicans. [18509109]
  • Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily. [12945048]
  • A novel LPS-inducible C-type lectin is a transcriptional target of NF-IL6 in macrophages. [10528209]
  • C-type lectin-like domains. [10508765]
UniProt Main References (8 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The finished DNA sequence of human chromosome 12. [16541075]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • The macrophage-inducible C-type lectin, mincle, is an essential component of the innate immune response to Candida albicans. [18490740]
  • Mincle is an ITAM-coupled activating receptor that senses damaged cells. [18776906]
  • C-type lectin MCL is an FcRgamma-coupled receptor that mediates the adjuvanticity of mycobacterial cord factor. [23602766]
  • Structural analysis for glycolipid recognition by the C-type lectins Mincle and MCL. [24101491]
All isoforms of this gene containing a lectin domain
XP_011518916.1, NP_055173.1, XP_011518917.1
RNA
RNA (Transcript ID: NM_014358.4)
C-type lectin domain family 4 member E
m7G-5')ppp(5'-AUUCAUUCUCCCUGAAUCUUACCAACAAAACACUCCUGAGGAGAAAGAAAGAGAGGGAGGGAGAGAAAAAGAGAGAGAGAGAAACAAAAAACCAAAGAGAGAGAAAAAAUGAAUUCAUCUAAAUCAUCUGAAACACAAUGCACAGAGAGAGGAUGCUUCUCUUCCCAAAUGUUCUUAUGGACUGUUGCUGGGAUCCCCAUCCUAUUUCUCAGUGCCUGUUUCAUCACCAGAUGUGUUGUGACAUUUCGCAUCUUUCAAACCUGUGAUGAGAAAAAGUUUCAGCUACCUGAGAAUUUCACAGAGCUCUCCUGCUACAAUUAUGGAUCAGGUUCAGUCAAGAAUUGUUGUCCAUUGAACUGGGAAUAUUUUCAAUCCAGCUGCUACUUCUUUUCUACUGACACCAUUUCCUGGGCGUUAAGUUUAAAGAACUGCUCAGCCAUGGGGGCUCACCUGGUGGUUAUCAACUCACAGGAGGAGCAGGAAUUCCUUUCCUACAAGAAACCUAAAAUGAGAGAGUUUUUUAUUGGACUGUCAGACCAGGUUGUCGAGGGUCAGUGGCAAUGGGUGGACGGCACACCUUUGACAAAGUCUCUGAGCUUCUGGGAUGUAGGGGAGCCCAACAACAUAGCUACCCUGGAGGACUGUGCCACCAUGAGAGACUCUUCAAACCCAAGGCAAAAUUGGAAUGAUGUAACCUGUUUCCUCAAUUAUUUUCGGAUUUGUGAAAUGGUAGGAAUAAAUCCUUUGAACAAAGGAAAAUCUCUUUAAGAACAGAAGGCACAACUCAAAUGUGUAAAGAAGGAAGAGCAAGAACAUGGCCACACCCACCGCCCCACACGAGAAAUUUGUGCGCUGAACUUCAAAGGACUUCAUAAGUAUUUGUUACUCUGAUAUAAAUAAAAAUAAGUAGUUUUAAAUGUUAUAAUUCAUGUUACUGGCUGAAGUGCAUUUUCUCUCUACGUUAGUCUCAGGUCCUCUUCCCAGAAUUUACAAAGCAAUUCACUACCUUUUGCUACAUUUGCCUCAUUUUUUAGUGUUCGUAUGAAAGUACAGGGACACGGAGCCAAGACAGAGUCUAGCAAAGAAGGGGAUUUUGGAAGGUGCCUUCCAAAAAUCUCCUGAAUCCGGGCUCUGUAGCAGGUCCUCUUCUUUCUAGCUUCUGACAAGUCUGUCUUCUCUUCUUGGUUUCAUACCGUUCUUAUCUCCUGCCCAAGCAUAUAUCGUCUCUUUACUCCCCUGUAUAAUGAGUAAGAAGCUUCUUCAAGUCAUGAAACUUAUUCCUGCUCAGAAUACCGGUGUGGCCUUUCUGGCUACAGGCCUCCACUGCACCUUCUUAGGGAAGGGCAUGCCAGCCAUCAGCUCCAAACAGGCUGUAACCAAGUCCACCCAUCCCUGGGGCUUCCUUUGCUCUGCCUUAUUUUCAAUUGACUGAAUGGAUCUCACCAGAUUUUGUAUCUAUUGCUCAGCUAGGACCCGAGUCCAAUAGUCAAUUUAUUCUAAGCGAACAUUCAUCUCCACACUUUCCUGUCUCAAGCCCAUCCAUUAUUUCUUAACUUUUAUUUUAGCUUUCGGGGGUACAUGUUAAAGGCUUUUUAUAUAGGUAAACUCAUGUCGUGGAGGUUUGUUGUACAGAUUAUUUCAUCACCCAGGUAUUAAGCCCAGUGCCUAAUAUUGUUUUUUUCGGCUCCUCUCCCUCCUCCUACCUUCCGCCCUCAAGUAGACUCCAGUGUCUGUUAUUCCCUUCUUUGUGUUUAUGAAUUCUCAUCAUUUAGCUCCCACUUAUAAGUGAGGACAUGCAGUAUUUGGUUUUCUGUUCCCAUGUUUGCUAAGGAUAAUGGUCUCCAGUUCUACCGAUGUUCCCACAAAAGACAUAAUCUUCUUUUUUAAGGCUGCUUAGUAUUCCAUGGUAUCUAUGUAUCACAUUUUCUCUAUCCAAUCUAUUGUUGACUCACAUUUAGAUUGAUUCCAUGUUUUUGCUAUUGUGAAUAGUGCUGCAAUGAACAUUCGUGUGCAUGUGUCUUUAUGGUAGAAAGAUUUAUAUUUCUCUGAGUAUGUAUCCAGUAAUAGCCCAUUCAUUUAUUGCAUAAAAUUCUACCAAUAC-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 26253)
C-type lectin domain family 4 member E
strand -
MINCLE
NCBI CDS gene sequence (660 bp)
5'-ATGAATTCATCTAAATCATCTGAAACACAATGCACAGAGAGAGGATGCTTCTCTTCCCAAATGTTCTTATGGACTGTTGCTGGGATCCCCATCCTATTTCTCAGTGCCTGTTTCATCACCAGATGTGTTGTGACATTTCGCATCTTTCAAACCTGTGATGAGAAAAAGTTTCAGCTACCTGAGAATTTCACAGAGCTCTCCTGCTACAATTATGGATCAGGTTCAGTCAAGAATTGTTGTCCATTGAACTGGGAATATTTTCAATCCAGCTGCTACTTCTTTTCTACTGACACCATTTCCTGGGCGTTAAGTTTAAAGAACTGCTCAGCCATGGGGGCTCACCTGGTGGTTATCAACTCACAGGAGGAGCAGGAATTCCTTTCCTACAAGAAACCTAAAATGAGAGAGTTTTTTATTGGACTGTCAGACCAGGTTGTCGAGGGTCAGTGGCAATGGGTGGACGGCACACCTTTGACAAAGTCTCTGAGCTTCTGGGATGTAGGGGAGCCCAACAACATAGCTACCCTGGAGGACTGTGCCACCATGAGAGACTCTTCAAACCCAAGGCAAAATTGGAATGATGTAACCTGTTTCCTCAATTATTTTCGGATTTGTGAAATGGTAGGAATAAATCCTTTGAACAAAGGAAAATCTCTTTAA-3'
NCBI CDS gene sequence with introns (location: 8534638.. 8540797) (6160 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 8533305.. 8540905) (7601 bp)Download
NCBI gene sequence (location: [8533305.. 8540905 + 1000]) (8601 bp)Download
Cite How to cite