NCBI Summary
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene is a member of the NKG2 group of genes that are expressed primarily in natural killer (NK) cells. These family members encode transmembrane proteins that are characterized by a type II membrane orientation (have an extracellular C-terminus) and the presence of a C-type lectin domain. This family member is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. Read-through transcription exists between this gene and the downstream KLRK1 (killer cell lectin-like receptor subfamily K, member 1) family member. [provided by RefSeq, Dec 2010].
Protein
Protein (NP_038459)
Killer cell lectin-like receptor C member 4
NKG2-F type II integral membrane protein (NK cell receptor F) (NKG2-F-activating NK receptor)
KLRC4
killer cell lectin like receptor C4
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
No structure currently available in the PDB RCSB Databank.
Structural models
SWISS-MODEL structural models
The location of the lectin domain structural model is: 102-143
We infer [1.58, 2.05] Å as the interval of error of this structural model.
Template 1: 6RYG chain: A, P23805, NP_783630.2, sequence identity: 26.2%, coverage: 95.2%, location in sequence: 250-371, (230-351 in PDB).
Template 2: 1PWB chain: A, P35247, NP_003010.4, sequence identity: 26.2%, coverage: 97.6%, location in sequence: 257-375, (237-355 in PDB).
Template 3: 5VYB chain: A, Q6EIG7, NP_001007034.1, sequence identity: 26.2%, coverage: 95.2%, location in sequence: 63-209, (63-209 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
We infer [1.58, 2.05] Å as the interval of error of this structural model.
Template 1: 6RYG chain: A, P23805, NP_783630.2, sequence identity: 26.2%, coverage: 95.2%, location in sequence: 250-371, (230-351 in PDB).
Template 2: 1PWB chain: A, P35247, NP_003010.4, sequence identity: 26.2%, coverage: 97.6%, location in sequence: 257-375, (237-355 in PDB).
Template 3: 5VYB chain: A, Q6EIG7, NP_001007034.1, sequence identity: 26.2%, coverage: 95.2%, location in sequence: 63-209, (63-209 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
- Screening for the Biomarkers Associated with Myocardial Infarction by Bioinformatics Analysis. [31502863]
- Genetic polymorphisms of C-type lectin receptors in Behcet's disease in a Chinese Han population. [28706259]
- Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behcet's disease in Iranians. [26097239]
- Genome-wide association analysis identifies new susceptibility loci for Behcet's disease and epistasis between HLA-B*51 and ERAP1. [23291587]
- Human NKG2F is expressed and can associate with DAP12. [15140575]
- Linkage of the NKG2 and CD94 receptor genes to D12S77 in the human natural killer gene complex. [9887346]
- The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex. [9683661]
- Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes. [9598306]
- Cloning of NKG2-F, a new member of the NKG2 family of human natural killer cell receptor genes. [9394807]
- A multigene family on human chromosome 12 encodes natural killer-cell lectins. [8436421]
UniProt Main References (3 PubMed Identifiers)
- Conservation and variation in human and common chimpanzee CD94 and NKG2 genes. [11751968]
- The finished DNA sequence of human chromosome 12. [16541075]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
RNA
RNA (Transcript ID: NM_013431.2)
m7G-5')ppp(5'-UAAAACUUUAGGAAAUUAGUACCAGACUUUUAUAUUGGUCAACAGCAAAAUGAACAUUACUACUCAGCCUCCAACACAUGCAGUUUGCCUAUACCAGGGAUCCUGUCAAAAUAUACACCACUUAUAGCUUCUUAAGUGCAGUUAUCAUAGAGCACAGUCCCUGACAUCACACAGCUGCAGAGAUGAAUAAACAAAGAGGAACCUACUCAGAAGUGAGUCUGGCCCAGGACCCAAAGAGGCAGCAAAGGAAACUUAAGGGCAAUAAAAUCUCCAUUUCAGGAACCAAACAGGAAAUAUUCCAAGUAGAAUUAAACCUUCAAAAUGCUUCUUCGGAUCAUCAAGGGAAUGACAAGACAUAUCACUGCAAAGGUUUACUGCCACCUCCAGAGAAGCUCACUGCUGAGGUCCUAGGAAUCAUUUGCAUUGUCCUGAUGGCCACUGUGUUAAAAACAAUAGUUCUUAUUCCUUGUAUUGGAGUACUGGAGCAGAACAAUUUUUCCCUGAAUAGAAGAAUGCAGAAAGCACGUCAUUGUGGCCAUUGUCCUGAGGAGUGGAUUACAUAUUCCAACAGUUGUUAUUACAUUGGUAAGGAAAGAAGAACUUGGGAAGAAAGAGUUUGCUGGCCUGUGCUUCGAAGAACUCUGAUCUGCUUUCUAUAGAUAAUGAGGAAGAAAUGGUAAGACGUAAAUGUUUCAACACUUUACUAAAAGCUUAUUUCUGUCAAUAUCAUAUUUGUAGAAAUCAUCCAUAUGUUUAUACAUAUAUUUACUUCAUAUAUUUUUAAGUCUGUGUAGUAUUCAACUGACUUCAUAAUAUUUUUAUAUUCAUAUACUGUUAAUGCACAUUUGGUUAUUUCCAGUUUUGCUUUUCAUGGAAACCCAUGCUUCUAUAAAUGUUUUUAUCACAAAAUAAAUAUAAAGAAAACUAA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 8302)
killer cell lectin like receptor C4
strand -
NCBI CDS gene sequence (477 bp)
5'-ATGAATAAACAAAGAGGAACCTACTCAGAAGTGAGTCTGGCCCAGGACCCAAAGAGGCAGCAAAGGAAACTTAAGGGCAATAAAATCTCCATTTCAGGAACCAAACAGGAAATATTCCAAGTAGAATTAAACCTTCAAAATGCTTCTTCGGATCATCAAGGGAATGACAAGACATATCACTGCAAAGGTTTACTGCCACCTCCAGAGAAGCTCACTGCTGAGGTCCTAGGAATCATTTGCATTGTCCTGATGGCCACTGTGTTAAAAACAATAGTTCTTATTCCTTGTATTGGAGTACTGGAGCAGAACAATTTTTCCCTGAATAGAAGAATGCAGAAAGCACGTCATTGTGGCCATTGTCCTGAGGAGTGGATTACATATTCCAACAGTTGTTATTACATTGGTAAGGAAAGAAGAACTTGGGAAGAAAGAGTTTGCTGGCCTGTGCTTCGAAGAACTCTGATCTGCTTTCTATAG-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.