NCBI Summary
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene is a member of the NKG2 group of genes that are expressed primarily in natural killer (NK) cells. These family members encode transmembrane proteins that are characterized by a type II membrane orientation (have an extracellular C-terminus) and the presence of a C-type lectin domain. This family member is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. Read-through transcription exists between this gene and the downstream KLRK1 (killer cell lectin-like receptor subfamily K, member 1) family member. [provided by RefSeq, Dec 2010].
Protein
Protein (NP_038459)
Killer cell lectin-like receptor C member 4
NKG2-F type II integral membrane protein (NK cell receptor F) (NKG2-F-activating NK receptor)
KLRC4
killer cell lectin like receptor C4
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
Uncharacterised
Undefined
Undefined
Undefined
Protein sequence and protein families (fasta) (158 amino acids) Download
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.58, 2.05] ÅDownload
The location of the lectin domain structural model is: 102-143
We infer [1.58, 2.05] Å as the interval of error of this structural model.
Template 1: 6RYG chain: A, P23805, NP_783630.2, sequence identity: 26.2%, coverage: 95.2%, location in sequence: 250-371, (230-351 in PDB).
Template 2: 1PWB chain: A, P35247, NP_003010.4, sequence identity: 26.2%, coverage: 97.6%, location in sequence: 257-375, (237-355 in PDB).
Template 3: 5VYB chain: A, Q6EIG7, NP_001007034.1, sequence identity: 26.2%, coverage: 95.2%, location in sequence: 63-209, (63-209 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Oligomerization and Known Interactions
Can form disulfide-bonded heterodimer with CD94
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • Screening for the Biomarkers Associated with Myocardial Infarction by Bioinformatics Analysis. [31502863]
  • Genetic polymorphisms of C-type lectin receptors in Behcet's disease in a Chinese Han population. [28706259]
  • Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behcet's disease in Iranians. [26097239]
  • Genome-wide association analysis identifies new susceptibility loci for Behcet's disease and epistasis between HLA-B*51 and ERAP1. [23291587]
  • Human NKG2F is expressed and can associate with DAP12. [15140575]
  • Linkage of the NKG2 and CD94 receptor genes to D12S77 in the human natural killer gene complex. [9887346]
  • The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex. [9683661]
  • Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes. [9598306]
  • Cloning of NKG2-F, a new member of the NKG2 family of human natural killer cell receptor genes. [9394807]
  • A multigene family on human chromosome 12 encodes natural killer-cell lectins. [8436421]
UniProt Main References (3 PubMed Identifiers)
  • Conservation and variation in human and common chimpanzee CD94 and NKG2 genes. [11751968]
  • The finished DNA sequence of human chromosome 12. [16541075]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
RNA
RNA (Transcript ID: NM_013431.2)
killer cell lectin like receptor C4
m7G-5')ppp(5'-UAAAACUUUAGGAAAUUAGUACCAGACUUUUAUAUUGGUCAACAGCAAAAUGAACAUUACUACUCAGCCUCCAACACAUGCAGUUUGCCUAUACCAGGGAUCCUGUCAAAAUAUACACCACUUAUAGCUUCUUAAGUGCAGUUAUCAUAGAGCACAGUCCCUGACAUCACACAGCUGCAGAGAUGAAUAAACAAAGAGGAACCUACUCAGAAGUGAGUCUGGCCCAGGACCCAAAGAGGCAGCAAAGGAAACUUAAGGGCAAUAAAAUCUCCAUUUCAGGAACCAAACAGGAAAUAUUCCAAGUAGAAUUAAACCUUCAAAAUGCUUCUUCGGAUCAUCAAGGGAAUGACAAGACAUAUCACUGCAAAGGUUUACUGCCACCUCCAGAGAAGCUCACUGCUGAGGUCCUAGGAAUCAUUUGCAUUGUCCUGAUGGCCACUGUGUUAAAAACAAUAGUUCUUAUUCCUUGUAUUGGAGUACUGGAGCAGAACAAUUUUUCCCUGAAUAGAAGAAUGCAGAAAGCACGUCAUUGUGGCCAUUGUCCUGAGGAGUGGAUUACAUAUUCCAACAGUUGUUAUUACAUUGGUAAGGAAAGAAGAACUUGGGAAGAAAGAGUUUGCUGGCCUGUGCUUCGAAGAACUCUGAUCUGCUUUCUAUAGAUAAUGAGGAAGAAAUGGUAAGACGUAAAUGUUUCAACACUUUACUAAAAGCUUAUUUCUGUCAAUAUCAUAUUUGUAGAAAUCAUCCAUAUGUUUAUACAUAUAUUUACUUCAUAUAUUUUUAAGUCUGUGUAGUAUUCAACUGACUUCAUAAUAUUUUUAUAUUCAUAUACUGUUAAUGCACAUUUGGUUAUUUCCAGUUUUGCUUUUCAUGGAAACCCAUGCUUCUAUAAAUGUUUUUAUCACAAAAUAAAUAUAAAGAAAACUAA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 8302)
killer cell lectin like receptor C4
strand -
NKG2-F
NCBI CDS gene sequence (477 bp)
5'-ATGAATAAACAAAGAGGAACCTACTCAGAAGTGAGTCTGGCCCAGGACCCAAAGAGGCAGCAAAGGAAACTTAAGGGCAATAAAATCTCCATTTCAGGAACCAAACAGGAAATATTCCAAGTAGAATTAAACCTTCAAAATGCTTCTTCGGATCATCAAGGGAATGACAAGACATATCACTGCAAAGGTTTACTGCCACCTCCAGAGAAGCTCACTGCTGAGGTCCTAGGAATCATTTGCATTGTCCTGATGGCCACTGTGTTAAAAACAATAGTTCTTATTCCTTGTATTGGAGTACTGGAGCAGAACAATTTTTCCCTGAATAGAAGAATGCAGAAAGCACGTCATTGTGGCCATTGTCCTGAGGAGTGGATTACATATTCCAACAGTTGTTATTACATTGGTAAGGAAAGAAGAACTTGGGAAGAAAGAGTTTGCTGGCCTGTGCTTCGAAGAACTCTGATCTGCTTTCTATAG-3'
NCBI CDS gene sequence with introns (location: 10407653.. 10409575) (1923 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 10407384.. 10409757) (2374 bp)Download
NCBI gene sequence (location: [10407384.. 10409757 + 1000]) (3374 bp)Download
Cite How to cite