NCBI Summary
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_037400)
Galectin 13
Galactoside-binding soluble lectin 13 (Galectin-13) (Gal-13) (Placental tissue protein 13) (PP13) (Placental protein 13)
LGALS13
galectin 13
Undefined
Low evidence
galectin-like
S-Type Lectins - Prototypical
b-sandwich / ConA-like
0.408
Protein sequence and protein families (fasta) (139 amino acids) Download
MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Homodimer; disulfide-linked
Annotation
Ligand
Glycan ligands from structural data
Gal(b1-4)Glc
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • A reference map of the human binary protein interactome. [32296183]
  • Placental Protein 13 (Galectin-13) Polarizes Neutrophils Toward an Immune Regulatory Phenotype. [32117288]
  • Galectin-13/placental protein 13: redox-active disulfides as switches for regulating structure, function and cellular distribution. [31584064]
  • Resetting the ligand binding site of placental protein 13/galectin-13 recovers its ability to bind lactose. [30413611]
  • Reduced placental protein 13 (PP13) in placental derived syncytiotrophoblast extracellular vesicles in preeclampsia - A novel tool to study the impaired cargo transmission of the placenta to the maternal organs. [29884298]
  • Homology modelling and molecular dynamics studies of human placental tissue protein 13 (galectin-13). [11742106]
  • Isolation and sequence analysis of a cDNA encoding human placental tissue protein 13 (PP13), a new lysophospholipase, homologue of human eosinophil Charcot-Leyden Crystal protein. [10527825]
  • DelGEF, an RCC1-related protein encoded by a gene on chromosome 11p14 critical for two forms of hereditary deafness. [10571079]
  • Mammalian lysophospholipases. [10395961]
  • Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17). [6856484]
UniProt Main References (3 PubMed Identifiers)
  • A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. [19497882]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Galectin-13, a different prototype galectin, does not bind beta-galacto-sides and forms dimers via intermolecular disulfide bridges between Cys-136 and Cys-138. [29343868]
All isoforms of this gene containing a lectin domain
NP_037400.1, XP_024307242.1, XP_011525176.1, XP_016882204.1
RNA
RNA (Transcript ID: NM_013268.3)
galectin 13
m7G-5')ppp(5'-AGAAGACUGGACUCAAUUCUGAAGGUCGCCAAGAAGGAGAGAACAAUGUCUUCUUUACCCGUGCCAUACAAACUGCCUGUGUCUUUGUCUGUUGGUUCCUGCGUGAUAAUCAAAGGGACACCAAUCCACUCUUUUAUCAAUGACCCACAGCUGCAGGUGGAUUUCUACACUGACAUGGAUGAGGAUUCAGAUAUUGCCUUCCGUUUCCGAGUGCACUUUGGCAAUCAUGUGGUCAUGAACAGGCGUGAGUUUGGGAUAUGGAUGUUGGAGGAGACAACAGACUACGUGCCCUUUGAGGAUGGCAAACAAUUUGAGCUGUGCAUCUACGUACAUUACAAUGAGUAUGAGAUAAAGGUCAAUGGCAUACGCAUUUACGGCUUUGUCCAUCGAAUCCCGCCAUCAUUUGUGAAGAUGGUGCAAGUGUCGAGAGAUAUCUCCCUGACCUCAGUGUGUGUCUGCAAUUGAGGGAGAUGAUCACACUCCUCAUUGUUGAGGAAUCCCUCUUUCUACCUGACCAUGGGAUUCCCAGAACCUGCUAACAGAAUAAUCCCUGCUCACAUUUUCCCCUACACUUUGUCAUUAAAACAGCACGAAAACUCA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 29124)
galectin 13
strand +
PP13, PLAC8
NCBI CDS gene sequence (420 bp)
5'-ATGTCTTCTTTACCCGTGCCATACAAACTGCCTGTGTCTTTGTCTGTTGGTTCCTGCGTGATAATCAAAGGGACACCAATCCACTCTTTTATCAATGACCCACAGCTGCAGGTGGATTTCTACACTGACATGGATGAGGATTCAGATATTGCCTTCCGTTTCCGAGTGCACTTTGGCAATCATGTGGTCATGAACAGGCGTGAGTTTGGGATATGGATGTTGGAGGAGACAACAGACTACGTGCCCTTTGAGGATGGCAAACAATTTGAGCTGTGCATCTACGTACATTACAATGAGTATGAGATAAAGGTCAATGGCATACGCATTTACGGCTTTGTCCATCGAATCCCGCCATCATTTGTGAAGATGGTGCAAGTGTCGAGAGATATCTCCCTGACCTCAGTGTGTGTCTGCAATTGA-3'
NCBI CDS gene sequence with introns (location: 39602569.. 39607339) (4771 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 39602524.. 39607474) (4951 bp)Download
NCBI gene sequence (location: [39602524 - 1000].. 39607474) (5951 bp)Download
Cite How to cite