NCBI Summary
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster. [provided by RefSeq, Dec 2010].
Protein
Protein (NP_031386)
Killer cell lectin-like receptor K member 1
NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
KLRK1
killer cell lectin like receptor K1
Low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
Complex N-glycans / Heparan
0.316
Protein sequence and protein families (fasta) (216 amino acids) Download
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Altered NK-cell compartment and dysfunctional NKG2D/NKG2D-ligand axis in patients with ataxia-telangiectasia. [34298181]
  • Tumor-derived NKG2D ligand sMIC reprograms NK cells to an inflammatory phenotype through CBM signalosome activation. [34294876]
  • Differential Effects of Histone Deacetylases on the Expression of NKG2D Ligands and NK Cell-Mediated Anticancer Immunity in Lung Cancer Cells. [34203519]
  • Roles of the NKG2D immunoreceptor and its ligands. [14523385]
  • An activating immunoreceptor complex formed by NKG2D and DAP10. [10426994]
  • Activation of NK cells and T cells by NKG2D, a receptor for stress-inducible MICA. [10426993]
  • The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex. [9683661]
  • Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes. [9598306]
  • Cloning of NKG2-F, a new member of the NKG2 family of human natural killer cell receptor genes. [9394807]
  • DNA sequence analysis of NKG2, a family of related cDNA clones encoding type II integral membrane proteins on human natural killer cells. [2007850]
UniProt Main References (19 PubMed Identifiers)
  • Conservation and variation in human and common chimpanzee CD94 and NKG2 genes. [11751968]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The finished DNA sequence of human chromosome 12. [16541075]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • DAP10 and DAP12 form distinct, but functionally cooperative, receptor complexes in natural killer cells. [11015446]
  • Costimulation of CD8alphabeta T cells by NKG2D via engagement by MIC induced on virus-infected cells. [11224526]
  • UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells. [11777960]
  • Lymphocyte activation via NKG2D: towards a new paradigm in immune recognition? [11973127]
  • Two human ULBP/RAET1 molecules with transmembrane regions are ligands for NKG2D. [15240696]
  • A Structural basis for the association of DAP12 with mouse, but not human, NKG2D. [15294961]
  • Show more
All isoforms of this gene containing a lectin domain
NP_001186734.1, NP_031386.2
RNA
RNA (Transcript ID: NM_007360.4)
killer cell lectin like receptor K1
m7G-5')ppp(5'-ACUUUCAAUUCUAGAUCAGGAACUGAGGACAUAUCUAAAUUUUCUAGUUUUAUAGAAGGCUUUUAUCCACAAGAAUCAAGAUCUUCCCUCUCUGAGCAGGAAUCCUUUGUGCAUUGAAGACUUUAGAUUCCUCUCUGCGGUAGACGUGCACUUAUAAGUAUUUGAUGGGGUGGAUUCGUGGUCGGAGGUCUCGACACAGCUGGGAGAUGAGUGAAUUUCAUAAUUAUAACUUGGAUCUGAAGAAGAGUGAUUUUUCAACACGAUGGCAAAAGCAAAGAUGUCCAGUAGUCAAAAGCAAAUGUAGAGAAAAUGCAUCUCCAUUUUUUUUCUGCUGCUUCAUCGCUGUAGCCAUGGGAAUCCGUUUCAUUAUUAUGGUAACAAUAUGGAGUGCUGUAUUCCUAAACUCAUUAUUCAACCAAGAAGUUCAAAUUCCCUUGACCGAAAGUUACUGUGGCCCAUGUCCUAAAAACUGGAUAUGUUACAAAAAUAACUGCUACCAAUUUUUUGAUGAGAGUAAAAACUGGUAUGAGAGCCAGGCUUCUUGUAUGUCUCAAAAUGCCAGCCUUCUGAAAGUAUACAGCAAAGAGGACCAGGAUUUACUUAAACUGGUGAAGUCAUAUCAUUGGAUGGGACUAGUACACAUUCCAACAAAUGGAUCUUGGCAGUGGGAAGAUGGCUCCAUUCUCUCACCCAACCUACUAACAAUAAUUGAAAUGCAGAAGGGAGACUGUGCACUCUAUGCCUCGAGCUUUAAAGGCUAUAUAGAAAACUGUUCAACUCCAAAUACGUACAUCUGCAUGCAAAGGACUGUGUAAAGAUGAUCAACCAUCUCAAUAAAAGCCAGGAACAGAGAAGAGAUUACACCAGCGGUAACACUGCCAACUGAGACUAAAGGAAACAAACAAAAACAGGACAAAAUGACCAAAGACUGUCAGAUUUCUUAGACUCCACAGGACCAAACCAUAGAACAAUUUCACUGCAAACAUGCAUGAUUCUCCAAGACAAAAGAAGAGAGAUCCUAAAGGCAAUUCAGAUAUCCCCAAGGCUGCCUCUCCCACCACAAGCCCAGAGUGGAUGGGCUGGGGGAGGGGUGCUGUUUUAAUUUCUAAAGGUAGGACCAACACCCAGGGGAUCAGUGAAGGAAGAGAAGGCCAGCAGAUCACUGAGAGUGCAACCCCACCCUCCACAGGAAAUUGCCUCAUGGGCAGGGCCACAGCAGAGAGACACAGCAUGGGCAGUGCCUUCCCUGCCUGUGGGGGUCAUGCUGCCACUUUUAAUGGGUCCUCCACCCAACGGGGUCAGGGAGGUGGUGCUGCCCCAGUGGGCCAUGAUUAUCUUAAAGGCAUUAUUCUCCAGCCUUAAGUAAGAUCUUAGGACGUUUCCUUUGCUAUGAUUUGUACUUGCUUGAGUCCCAUGACUGUUUCUCUUCCUCUCUUUCUUCCUUUUGGAAUAGUAAUAUCCAUCCUAUGUUUGUCCCACUAUUGUAUUUUGGAAGCACAUAACUUGUUUGGUUUCACAGGUUCACAGUUAAGAAGGAAUUUUGCCUCUGAAUAAAUAGAAUCUUGAGUCUCAUGCA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 22914)
killer cell lectin like receptor K1
strand -
NKG2D, KLR, NKG2-D, CD314
NCBI CDS gene sequence (651 bp)
5'-ATGGGGTGGATTCGTGGTCGGAGGTCTCGACACAGCTGGGAGATGAGTGAATTTCATAATTATAACTTGGATCTGAAGAAGAGTGATTTTTCAACACGATGGCAAAAGCAAAGATGTCCAGTAGTCAAAAGCAAATGTAGAGAAAATGCATCTCCATTTTTTTTCTGCTGCTTCATCGCTGTAGCCATGGGAATCCGTTTCATTATTATGGTAACAATATGGAGTGCTGTATTCCTAAACTCATTATTCAACCAAGAAGTTCAAATTCCCTTGACCGAAAGTTACTGTGGCCCATGTCCTAAAAACTGGATATGTTACAAAAATAACTGCTACCAATTTTTTGATGAGAGTAAAAACTGGTATGAGAGCCAGGCTTCTTGTATGTCTCAAAATGCCAGCCTTCTGAAAGTATACAGCAAAGAGGACCAGGATTTACTTAAACTGGTGAAGTCATATCATTGGATGGGACTAGTACACATTCCAACAAATGGATCTTGGCAGTGGGAAGATGGCTCCATTCTCTCACCCAACCTACTAACAATAATTGAAATGCAGAAGGGAGACTGTGCACTCTATGCCTCGAGCTTTAAAGGCTATATAGAAAACTGTTCAACTCCAAATACGTACATCTGCATGCAAAGGACTGTGTAA-3'
NCBI CDS gene sequence with introns (location: 10373114.. 10388810) (15697 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 10372353.. 10390041) (17689 bp)Download
NCBI gene sequence (location: [10372353.. 10390041 + 1000]) (18689 bp)Download
Cite How to cite