NCBI Summary
This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobial lectin with activity against Gram-positive bacteria. Alternative splicing results in multiple transcript variants encoding multiple isoforms. [provided by RefSeq, Nov 2014].
Protein
Protein (NP_001008388)
Regenerating family member 3 gamma
Regenerating islet-derived protein 3-gamma (REG-3-gamma) (Pancreatitis-associated protein 1B) (PAP-1B) (Pancreatitis-associated protein IB) (PAP IB) (Regenerating islet-derived protein III-gamma) (REG III) (Reg III-gamma) [Cleaved into: Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form]
REG3G
regenerating family member 3 gamma
Undefined
Curated
C-type lectin
Undefined
C-type - Free C-type Lectin Domains CTLDs
a/b mixed / C-type lectin-like
Chitin / peptidoglycan
0.36
MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
No structure currently available in the PDB RCSB Databank.
Structural models
SWISS-MODEL structural models
The location of the lectin domain structural model is: 24-174
We infer [1.63, 2.14] Å as the interval of error of this structural model.
Template 1: 6JJJ chain: A, P70194, NP_058031.2, sequence identity: 22.5%, coverage: 92.7%, location in sequence: 393-543, (393-543 in PDB).
Template 2: 3WHD chain: C, Q8WXI8, NP_525126.2, sequence identity: 21.2%, coverage: 93.4%, location in sequence: 63-215, (63-215 in PDB).
Template 3: 5VYB chain: A, Q6EIG7, NP_001007034.1, sequence identity: 20.5%, coverage: 92.1%, location in sequence: 63-209, (63-209 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
We infer [1.63, 2.14] Å as the interval of error of this structural model.
Template 1: 6JJJ chain: A, P70194, NP_058031.2, sequence identity: 22.5%, coverage: 92.7%, location in sequence: 393-543, (393-543 in PDB).
Template 2: 3WHD chain: C, Q8WXI8, NP_525126.2, sequence identity: 21.2%, coverage: 93.4%, location in sequence: 63-215, (63-215 in PDB).
Template 3: 5VYB chain: A, Q6EIG7, NP_001007034.1, sequence identity: 20.5%, coverage: 92.1%, location in sequence: 63-209, (63-209 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Oligomerization and Known Interactions
Forms a hexameric membrane-permeabilizing oligomeric pore on membrane phospholipids. The hexamer is formed by three dimers related by helical symmetry. Forms filaments, filamentation traps pore complexes and limits damage to host cells. Interacts with EXTL3
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (9 PubMed Identifiers)
- Myocardial Accumulations of Reg3A, Reg3gamma and Oncostatin M Are Associated with the Formation of Granulomata in Patients with Cardiac Sarcoidosis. [33923774]
- Role of oncogenic REGgamma in cancer. [32935661]
- Proteasome-dependent degradation of Smad7 is critical for lung cancer metastasis. [31767934]
- Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia. [24152035]
- Helicobacter pylori CagA triggers expression of the bactericidal lectin REG3gamma via gastric STAT3 activation. [22312430]
- Symbiotic bacteria direct expression of an intestinal bactericidal lectin. [16931762]
- PAP IB, a new member of the Reg gene family: cloning, expression, structural properties, and evolution by gene duplication. [15777617]
- Signal peptide prediction based on analysis of experimentally verified cleavage sites. [15340161]
- Molecular cloning, expression and chromosomal localization of a novel human REG family gene, REG III. [15556304]
UniProt Main References (5 PubMed Identifiers)
- The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- Generation and annotation of the DNA sequences of human chromosomes 2 and 4. [15815621]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment. [19095652]
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_001008387.3)
regenerating family member 3 gamma, transcript variant 1
m7G-5')ppp(5'-AUCCCUGAGAUCUUUUUAUAAAAAACCCAGUCUUUGCUGACCAGACAAAGCAUACCAGAUCUCACCAGAGAGUCCUAGGGGACUACAGAAGGAAAAAGACAAGAGGCAGUAGGAUAUCUGUGUGUCCUCCCGCUGACCACACUUCCUUUAGUGACCCGAUUGCCUCCUCAAGUCGCAGACACUAUGCUGCCUCCCAUGGCCCUGCCCAGUGUGUCCUGGAUGCUGCUUUCCUGCCUCAUUCUCCUGUGUCAGGUUCAAGGUGAAGAAACCCAGAAGGAACUGCCCUCUCCACGGAUCAGCUGUCCCAAAGGCUCCAAGGCCUAUGGCUCCCCCUGCUAUGCCUUGUUUUUGUCACCAAAAUCCUGGAUGGAUGCAGAUCUGGCUUGCCAGAAGCGGCCCUCUGGAAAACUGGUGUCUGUGCUCAGUGGGGCUGAGGGAUCCUUCGUGUCCUCCCUGGUGAGGAGCAUUAGUAACAGCUAUUCAUACAUCUGGAUUGGGCUCCAUGACCCCACACAGGGCUCUGAGCCUGAUGGAGAUGGAUGGGAGUGGAGUAGCACUGAUGUGAUGAAUUACUUUGCAUGGGAGAAAAAUCCCUCCACCAUCUUAAACCCUGGCCACUGUGGGAGCCUGUCAAGAAGCACAGGAUUUCUGAAGUGGAAAGAUUAUAACUGUGAUGCAAAGUUACCCUAUGUCUGCAAGUUCAAGGACUAGGGCAGGUGGGAAGUCAGCAGCCUGAGCUUGGCGUGCAGCUCAUCAUGGACAUGAGACCAGUGUGAAGACUCACCCUGGAAGAGAAUAUUCUCCCCAAACUGCCCUACCUGACUACCUUGUCAUGAUCCUCCUUCUUUUUCCUUUUUCUUCACCUUCAUUUCAGGCUUUUCUCUGUCUUCCAUGUCUUGAGAUCUCAGAGAAUAAUAAUAAAAAUGUUACUUUAUA-3'- Poly-A tail - Coding region
DNA
DNA (Gene ID: 130120)
regenerating family member 3 gamma
strand +
UNQ429, LPPM429, PAP1B
NCBI CDS gene sequence (528 bp)
5'-ATGCTGCCTCCCATGGCCCTGCCCAGTGTGTCCTGGATGCTGCTTTCCTGCCTCATTCTCCTGTGTCAGGTTCAAGGTGAAGAAACCCAGAAGGAACTGCCCTCTCCACGGATCAGCTGTCCCAAAGGCTCCAAGGCCTATGGCTCCCCCTGCTATGCCTTGTTTTTGTCACCAAAATCCTGGATGGATGCAGATCTGGCTTGCCAGAAGCGGCCCTCTGGAAAACTGGTGTCTGTGCTCAGTGGGGCTGAGGGATCCTTCGTGTCCTCCCTGGTGAGGAGCATTAGTAACAGCTATTCATACATCTGGATTGGGCTCCATGACCCCACACAGGGCTCTGAGCCTGATGGAGATGGATGGGAGTGGAGTAGCACTGATGTGATGAATTACTTTGCATGGGAGAAAAATCCCTCCACCATCTTAAACCCTGGCCACTGTGGGAGCCTGTCAAGAAGCACAGGATTTCTGAAGTGGAAAGATTATAACTGTGATGCAAAGTTACCCTATGTCTGCAAGTTCAAGGACTAG-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.