NCBI Summary
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_006140)
Galectin 4
Galectin-4 (Gal-4) (Antigen NY-CO-27) (L-36 lactose-binding protein) (L36LBP) (Lactose-binding lectin 4)
LGALS4
galectin 4
Undefined
Curated
Galectin
S-Type Lectins - Tandem repeat
b-sandwich / ConA-like
0.486
Protein sequence and protein families (fasta) (323 amino acids) Download
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
bGal13bGlcNAc13bGal14GlcNAC
Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)Glc
bGal14bGlcNAc13bGal14GlcNAC
Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
bGal14Glc
Gal(b1-4)Glc
aFuc12bGal14Glc
Fuc(a1-2)Gal(b1-4)Glc
References
NCBI References (10 PubMed Identifiers)
  • Evaluation of Serum and Gene Expression of Galectin-4, Interleukin-27, and Complement-7 in Hepatitis C Virus-Infected Egyptian Patients. [33381596]
  • SLPI facilitates cell migration by regulating lamellipodia/ruffles and desmosomes, in which Galectin4 plays an important role. [33016205]
  • A reference map of the human binary protein interactome. [32296183]
  • How presence of a signal peptide affects human galectins-1 and -4: Clues to explain common absence of a leader sequence among adhesion/growth-regulatory galectins. [31678146]
  • LGALS4 as a Prognostic Factor in Urothelial Carcinoma of Bladder Affects Cell Functions. [31558111]
  • Galectin-4 binds to sulfated glycosphingolipids and carcinoembryonic antigen in patches on the cell surface of human colon adenocarcinoma cells. [15546874]
  • High-affinity binding of recombinant human galectin-4 to SO(3)(-)-->3Galbeta1-->3GalNAc pyranoside. [11971864]
  • Cloning and expression of the mRNA of human galectin-4, an S-type lectin down-regulated in colorectal cancer. [9310382]
  • Strikingly different localization of galectin-3 and galectin-4 in human colon adenocarcinoma T84 cells. Galectin-4 is localized at sites of cell adhesion. [9162064]
  • Galectins. Structure and function of a large family of animal lectins. [8063692]
UniProt Main References (1 PubMed Identifiers)
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
All isoforms of this gene containing a lectin domain
NP_006140.1, XP_011525275.1, XP_011525276.1
RNA
RNA (Transcript ID: NM_006149.4)
galectin 4
m7G-5')ppp(5'-ACCAUCUCCCACUCCUGCAGCUCUUCUCACAGGACCAGCCACUAGCGCAGCCUCGAGCGAUGGCCUAUGUCCCCGCACCGGGCUACCAGCCCACCUACAACCCGACGCUGCCUUACUACCAGCCCAUCCCGGGCGGGCUCAACGUGGGAAUGUCUGUUUACAUCCAAGGAGUGGCCAGCGAGCACAUGAAGCGGUUCUUCGUGAACUUUGUGGUUGGGCAGGAUCCGGGCUCAGACGUCGCCUUCCACUUCAAUCCGCGGUUUGACGGCUGGGACAAGGUGGUCUUCAACACGUUGCAGGGCGGGAAGUGGGGCAGCGAGGAGAGGAAGAGGAGCAUGCCCUUCAAAAAGGGUGCCGCCUUUGAGCUGGUCUUCAUAGUCCUGGCUGAGCACUACAAGGUGGUGGUAAAUGGAAAUCCCUUCUAUGAGUACGGGCACCGGCUUCCCCUACAGAUGGUCACCCACCUGCAAGUGGAUGGGGAUCUGCAACUUCAAUCAAUCAACUUCAUCGGAGGCCAGCCCCUCCGGCCCCAGGGACCCCCGAUGAUGCCACCUUACCCUGGUCCCGGACAUUGCCAUCAACAGCUGAACAGCCUGCCCACCAUGGAAGGACCCCCAACCUUCAACCCGCCUGUGCCAUAUUUCGGGAGGCUGCAAGGAGGGCUCACAGCUCGAAGAACCAUCAUCAUCAAGGGCUAUGUGCCUCCCACAGGCAAGAGCUUUGCUAUCAACUUCAAGGUGGGCUCCUCAGGGGACAUAGCUCUGCACAUUAAUCCCCGCAUGGGCAACGGUACCGUGGUCCGGAACAGCCUUCUGAAUGGCUCGUGGGGAUCCGAGGAGAAGAAGAUCACCCACAACCCAUUUGGUCCCGGACAGUUCUUUGAUCUGUCCAUUCGCUGUGGCUUGGAUCGCUUCAAGGUUUACGCCAAUGGCCAGCACCUCUUUGACUUUGCCCAUCGCCUCUCGGCCUUCCAGAGGGUGGACACAUUGGAAAUCCAGGGUGAUGUCACCUUGUCCUAUGUCCAGAUCUAAUCUAUUCCUGGGGCCAUAACUCAUGGGAAAACAGAAUUAUCCCCUAGGACUCCUUUCUAAGCCCCUAAUAAAAUGUCUGAGGGUGUCUCA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 3960)
galectin 4
strand -
GAL4
NCBI CDS gene sequence (972 bp)
5'-ATGGCCTATGTCCCCGCACCGGGCTACCAGCCCACCTACAACCCGACGCTGCCTTACTACCAGCCCATCCCGGGCGGGCTCAACGTGGGAATGTCTGTTTACATCCAAGGAGTGGCCAGCGAGCACATGAAGCGGTTCTTCGTGAACTTTGTGGTTGGGCAGGATCCGGGCTCAGACGTCGCCTTCCACTTCAATCCGCGGTTTGACGGCTGGGACAAGGTGGTCTTCAACACGTTGCAGGGCGGGAAGTGGGGCAGCGAGGAGAGGAAGAGGAGCATGCCCTTCAAAAAGGGTGCCGCCTTTGAGCTGGTCTTCATAGTCCTGGCTGAGCACTACAAGGTGGTGGTAAATGGAAATCCCTTCTATGAGTACGGGCACCGGCTTCCCCTACAGATGGTCACCCACCTGCAAGTGGATGGGGATCTGCAACTTCAATCAATCAACTTCATCGGAGGCCAGCCCCTCCGGCCCCAGGGACCCCCGATGATGCCACCTTACCCTGGTCCCGGACATTGCCATCAACAGCTGAACAGCCTGCCCACCATGGAAGGACCCCCAACCTTCAACCCGCCTGTGCCATATTTCGGGAGGCTGCAAGGAGGGCTCACAGCTCGAAGAACCATCATCATCAAGGGCTATGTGCCTCCCACAGGCAAGAGCTTTGCTATCAACTTCAAGGTGGGCTCCTCAGGGGACATAGCTCTGCACATTAATCCCCGCATGGGCAACGGTACCGTGGTCCGGAACAGCCTTCTGAATGGCTCGTGGGGATCCGAGGAGAAGAAGATCACCCACAACCCATTTGGTCCCGGACAGTTCTTTGATCTGTCCATTCGCTGTGGCTTGGATCGCTTCAAGGTTTACGCCAATGGCCAGCACCTCTTTGACTTTGCCCATCGCCTCTCGGCCTTCCAGAGGGTGGACACATTGGAAATCCAGGGTGATGTCACCTTGTCCTATGTCCAGATCTAA-3'
NCBI CDS gene sequence with introns (location: 38801764.. 38812886) (11123 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 38801674.. 38812945) (11272 bp)Download
NCBI gene sequence (location: [38801674.. 38812945 + 1000]) (12272 bp)Download
Cite How to cite