NCBI Summary
The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency. [provided by RefSeq, Jul 2015].
Protein
Protein (NP_005561)
ERGIC-53 - lectin, mannose binding 1
Protein ERGIC-53 (ER-Golgi intermediate compartment 53 kDa protein) (Gp58) (Intracellular mannose-specific lectin MR60) (Lectin mannose-binding 1)
LMAN1
lectin, mannose binding 1
Undefined
Curated
ERGIC-VIP L-type
L-Type Lectins
b-sandwich / ConA-like
0.897
Protein sequence and protein families (fasta) (510 amino acids) Download
MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
aMan 12 Man
Man(a1-2)Man
Man
References
NCBI References (10 PubMed Identifiers)
  • Mannan-Binding Lectin Suppresses Peptidoglycan-Induced TLR2 Activation and Inflammatory Responses. [30728747]
  • Multiple coagulation factor deficiency protein 2 as a crucial component in metastasis of human oral cancer. [29679592]
  • Combined deficiency of factors V and VIII by chance coinheritance of parahaemophilia and haemophilia A, but not by mutations of either LMAN1 or MCFD2, in a Japanese family. [29082580]
  • Characterization of the Extracellular Matrix of Normal and Diseased Tissues Using Proteomics. [28675934]
  • Crystal structure of the LMAN1-CRD/MCFD2 transport receptor complex provides insight into combined deficiency of factor V and factor VIII. [20138881]
  • The locus for combined factor V-factor VIII deficiency (F5F8D) maps to 18q21, between D18S849 and D18S1103. [9245995]
  • Mapping of the MR60/ERGIC-53 gene to human chromosome 18q21.3-18q22 by in situ hybridization. [8854877]
  • ERGIC-53, a membrane protein of the endoplasmic reticulum-Golgi intermediate compartment, is identical to MR60, an intracellular mannose-specific lectin of myelomonocytic cells. [7876089]
  • A putative novel class of animal lectins in the secretory pathway homologous to leguminous lectins. [8205612]
  • ERGIC-53, a membrane protein of the ER-Golgi intermediate compartment, carries an ER retention motif. [8223692]
UniProt Main References (15 PubMed Identifiers)
  • ERGIC-53 gene structure and mutation analysis in 19 combined factors V and VIII deficiency families. [10090935]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. [12665801]
  • Cluster analysis of an extensive human breast cancer cell line protein expression map database. [11840567]
  • ER export of ERGIC-53 is controlled by cooperation of targeting determinants in all three of its domains. [13130098]
  • Bleeding due to disruption of a cargo-specific ER-to-Golgi transport complex. [12717434]
  • Oligomerization and interacellular localization of the glycoprotein receptor ERGIC-53 is independent of disulfide bonds. [16257008]
  • Initial characterization of the human central proteome. [21269460]
  • Protein interaction profiling of the p97 adaptor UBXD1 points to a role for the complex in modulating ERGIC-53 trafficking. [22337587]
  • TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport. [24806965]
  • Show more
RNA
RNA (Transcript ID: NM_005570.4)
lectin, mannose binding 1
m7G-5')ppp(5'-CUCCGCGUUCCAGAAUCCAAGAUGGCGGGAUCCAGGCAAAGGGGUCUCCGGGCCAGAGUUCGGCCGCUGUUCUGCGCCUUGCUGCUGUCACUCGGUCGCUUCGUCCGGGGCGACGGCGUGGGAGGAGACCCCGCGGUCGCGUUGCCACAUCGCCGUUUCGAGUACAAAUACAGCUUCAAGGGGCCGCACCUGGUGCAGAGCGACGGGACCGUGCCCUUCUGGGCCCACGCGGGGAAUGCUAUUCCAAGUUCAGAUCAAAUUCGAGUAGCACCAUCUUUAAAAAGCCAAAGAGGCUCAGUGUGGACAAAGACAAAAGCGGCCUUUGAGAACUGGGAAGUUGAGGUGACAUUUCGAGUGACUGGAAGAGGUCGAAUUGGAGCUGAUGGCCUAGCAAUUUGGUAUGCAGAAAAUCAAGGCUUGGAGGGCCCUGUGUUUGGAUCAGCUGAUCUGUGGAAUGGUGUUGGAAUAUUUUUUGAUUCUUUUGACAAUGAUGGAAAGAAAAAUAAUCCUGCUAUAGUAAUUAUAGGCAACAAUGGACAAAUCCAUUAUGACCAUCAAAAUGACGGGGCUAGUCAAGCUUUGGCAAGUUGCCAGAGGGACUUCCGCAACAAACCCUAUCCUGUCCGAGCAAAGAUUACCUAUUACCAGAACACACUGACAGUAAUGAUCAAUAAUGGCUUUACACCAGAUAAAAAUGAUUAUGAAUUUUGUGCCAAAGUGGAAAAUAUGAUUAUCCCUGCACAAGGGCAUUUUGGAAUAUCUGCUGCAACUGGAGGUCUUGCAGAUGACCAUGAUGUCCUUUCUUUUCUGACUUUCCAGUUGACUGAACCUGGAAAAGAGCCGCCCACACCAGAUAAAGAAAUUUCGGAAAAGGAAAAAGAAAAGUAUCAGGAGGAAUUUGAGCACUUUCAACAAGAAUUGGAUAAAAAAAAAGAGGAAUUCCAGAAGGGCCACCCCGACCUCCAAGGGCAGCCUGCGGAGGAAAUAUUUGAGAGUGUAGGAGAUCGAGAGCUAAGACAAGUCUUUGAAGGACAGAAUCGUAUUCAUCUUGAAAUCAAGCAGCUGAACCGGCAGUUAGAUAUGAUUCUUGAUGAACAGAGAAGAUAUGUCUCUUCCUUAACAGAGGAAAUCUCUAAAAGAGGAGCAGGAAUGCCUGGGCAGCAUGGGCAGAUUACUCAACAAGAACUGGAUACUGUUGUGAAAACUCAGCAUGAGAUUCUGAGACAAGUAAAUGAAAUGAAAAAUUCCAUGAGUGAAACCGUCAGACUGGUCAGUGGAAUGCAGCACCCUGGCUCUGCUGGAGGCGUCUAUGAGACAACACAGCACUUCAUUGACAUCAAAGAGCACCUGCACAUAGUAAAGAGGGACAUAGAUAACUUAGUGCAGCGAAAUAUGCCAUCAAAUGAAAAGCCGAAAUGCCCAGAACUACCACCAUUUCCAUCAUGUUUGUCUACGGUCCACUUCAUUAUAUUUGUUGUGGUGCAAACUGUAUUAUUCAUUGGUUAUAUCAUGUAUAGGUCUCAGCAAGAAGCAGCUGCCAAAAAAUUCUUUUGACUACCAUUUUCCUGUGUACUUCAUCUAUUUGUGUACAAAAUGAUGUCGUUUUGAGGGAAUUUAAGUAUUUAAAUUGCUUCAUAGUCUAAAUUAUUAAUUUUCUUAAUAAAAUAACUGUUUAAACAUUGAUUUGCAGUUAAGAAUAAACCUUAAAGCAAAGACAACCACAUUUUAAUUUGUUCACAGUAUGUAAAUCUGUCUAAAUUUCAGUGAAUUUCUGGUCAGUAUGAUGCAGCCUCUGAGCAGAAUAUUGACCAGUAAGAGGGUAAAUAAAGUGGGGGCAACCCCUGGAUAUGAAUGUUACCCCCUAAGUCUCCAAUAUUGCAGGUUUCCCUGUAUAACGUAAACACACUUGCCCUCAUGCCUCCCAGAAUAUGAGGUCUAAUUAAGAAGUCCCAUCAGGUUUAUUUUGUAACCAAAGUCUUUUUUAGAGGUCAGACUUCCUAAUCAAAGGCCUGGGCCUGCAGUCCUUUCAUCUUAAUGCAACUUCCUUUGAAAUCAAAGAAUAUUUUGUCUGAGAGCUUUAAGGAUCUGGUAAUAGACUUCAAAAUGUUAAGUGAAAUUUUUUUUUCCUCUAUUUAUCAAUGAUAUAUUUCACUUUUAAAGGAAAUUUUAGAGGAAAAUUAAUAGCUGCUUUUUGCCUAAAAAACCUUGUGGGUGGAAACAUUCCUCUGAGAAUGGCUUUUAUAGGUAUUUUGCCUGGUAAUGUAUUCAUUCAUGAUUGCCCAUAUUCUUGAAUGUCUUCAUUCCAAUGGGGUCAGGUCAAUAUUAUGAAAAUAAUUUUUAUAUUUAUAUUUGUAACUUAAGGAAUUUAUUUCUCCCUUUACUACAGCAUGUAAAUUCAGCUCAAAUUGCAUGAUCUGAGGAUUUAAAUUCACAAAACCUGCCACUACAUUCUGGUUUACAUUAGUUACUUCAUGCUGGCUGGGGUUAGUGACCAUUUGCAUACUCUUUUAAAUCAAGGAGGCUGUAGUAGAAGCAGUUUUAAGAUUCUUGAAGGCAAAAUUUGAAAAACAGUGAAUACUUCUAAUUGUUUCCUUUUAGUGCCAGAACUAAGGACAUUGUGAAGCACUUGUUAGUAAACUUAACCUUGAAAUGUCAGACUGGAAGGAGUUUUUAUAGUCUUUGUGCAUACUUCUAGGUAUUACAGAAACAGUCUGUAAAUGACAUUUUAAGAUGCAAAUUUAAUUCUGUUCACAGCUGAUUUAUACUGAUUUUUGCUGCCUUCAAAAUACUCUUUUACUUCUUUUAGCUAAAAUGGUUGUCUUUCAUUUGCCAUAGAAUUCCAAACAAUACUAUCUUAUAAAAUAGUACUGUUGAAUUAUUCCAAGCCUCCCUAGGUUUGCUCUCAAAUGUCAUUUACAGAUUGGGCUAACGACCUAAAAUCUAUAUAUAAAGACUUUCUGAAGAACUCUGUAUUAUAGCAAUACCAAACGAGUGCUGUGUGUGCAAACAGUCUGGCGUUGCUUUUUAUGUUGAUAUUUAUCCUAGAACACUGAAAGAGAAUAUGCCAGUGAUAACUCACUUUACUUCAGUCAUUUCAACACAGAAAAUGCUUCUCUAGCAUUUUUCUUUUGUAGUGUUAACAUUUUGAAAUUCAUGUUUCAGAGGCUUCAUCAUCACAGAAUUUACUCUUGCUCCAUGAAAAAAAAUUAAAUACCUUCAGAGGAAUAUUUAAGUUGUAAACUAUGAAACUUGAGAAAUCCUCUUGAGAUAAAAGGCUGCCAAAUCCAGUAUUAUAAAGUCCAUGGUCAUAUGUGCCUGUGCAUUAAAGGAAUACCAGAUCUAUGCAGUAUACAUUUUUCAGGCUGAAAUUCAAGGGGAAUCAUUCUGAUUAUUCUUACUACAAAUGGAGAUGGCUAUUAUGAAACAGCAUGAGCAUGAGCCUUUUAUCUUUUAUACUUAGUGAUAUACUUUGCUUGAAAAUCACUCAGCAAAGUAGUUCACAUGAUGUGUAUCAUAUUUGAAGUGUGGUUUUUCUCAAAAUCAUUGACUUUAAGGAGCUCAUUUCUGAACAAAAAGGUUUGCUCUGUGGAAAAAUCAAUCACUGCCAGGAUUCUUUCAUUUCUGUACUAUUUUGUAUAAUUGAAUUUGUUCACUUCUCUCACACCAGCAAGUGUUUUACAGGUGCCUUGGAUUAAAACAAAAUUGAUUUUAAAAUUUUUAUGUAAGUCAUUGUGUCUAUGAUGCCACUUUUAAAAGGAAAAUGCAAUUGCGUAAUGGCUUAUAUCCUUAUUUAAUGUACCUAUUUGUGUUCUAAUAAUUGUUUGAAUGUUUUAUUCAGCUUAAAACUUUACCAUGAAGUCAUAAACAGUAAACAAUGUUUUGUUAUGUAUUAAGGGGAUAUCAGUGUUUCUCAAAGUAUGAUCCAUGGACCAUCUGGGUCAUGGCGCCUGGUUUCAGACAACCUGAAUCAAAUCUUAGGGGUGGGGCUUUGGGAUGUCAUUGUUCAAUAGGCACCUCAGGAGAUUCUGAGCACACCAAUGUUUGAGAACCACUAAAAUGAGGAGUGGGAAAAAAAAAAUAGGUGUUUUGUUAAUUUAGAGCUGAGCUGAGAAGAUAAUAUAUUUUUAUUGUCAAUGACAUUAACAGAUAUGCACUGAUUCUUUUAUACCUACAAUUUACUUAAUGUUCCUUUUAUUAAAACGCGUGGUUCAUGAGCAACUACAGACUGAAUCCAGAUUAUUACCUGUUGCUUUCAGUAUUUUCGUGAUGGCUUUUAAUCUUAUGAAAUCAUCUUGAGAUCAUUCAUGGUCAAGCCAUGAAAACUCCCAUCUUCAAGCCUGCCUGCUAAAGCUUCUUUGCCUUCCUGAUUGUGAUUAUGGUAACAAUUUAUAUCAGACAGUUGUACUUUUUGAUAACUUAGGGAAAACAGAAAUGACUUGAACAAGGGAUUGCCUGCCUCACUGCAUUGCAGAGAUACAAUUUUUGUAAAGAACACAAAUAGCAGUUGUGAAUAUUAAGGUGUGAUUAUCUUUCCCUGUCCAUGUGCUUAUUGAAAGAAGAUAGUGAACAAAUGAUUAUAUUGAGGAUUUUUUUAAUUUAUAAGAUCUAAUGUGAAAUCCACACUUGGAACUUUUUAGAUCUGUCUGUUGCUUGUUUAAUAUAUUUCUUUUAUGACAUUACUUAAAGUUUAAAAGGGUUUUCUAUCCACUGUCAAUUUCAAUUGGAUAACAUUUUGUCAAGUUUUUUUUUUCCUGAUUAUUUGAUGCUAGCUGGAAUUCAAGAAAUGGCAUUGACCUUAUUCAAAUAAAGAAAUAUUUUAGUAAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 3998)
lectin, mannose binding 1
strand -
MR60, ERGIC-53, ERGIC53, gp58, MCFD1, FMFD1
NCBI CDS gene sequence (1533 bp)
5'-ATGGCGGGATCCAGGCAAAGGGGTCTCCGGGCCAGAGTTCGGCCGCTGTTCTGCGCCTTGCTGCTGTCACTCGGTCGCTTCGTCCGGGGCGACGGCGTGGGAGGAGACCCCGCGGTCGCGTTGCCACATCGCCGTTTCGAGTACAAATACAGCTTCAAGGGGCCGCACCTGGTGCAGAGCGACGGGACCGTGCCCTTCTGGGCCCACGCGGGGAATGCTATTCCAAGTTCAGATCAAATTCGAGTAGCACCATCTTTAAAAAGCCAAAGAGGCTCAGTGTGGACAAAGACAAAAGCGGCCTTTGAGAACTGGGAAGTTGAGGTGACATTTCGAGTGACTGGAAGAGGTCGAATTGGAGCTGATGGCCTAGCAATTTGGTATGCAGAAAATCAAGGCTTGGAGGGCCCTGTGTTTGGATCAGCTGATCTGTGGAATGGTGTTGGAATATTTTTTGATTCTTTTGACAATGATGGAAAGAAAAATAATCCTGCTATAGTAATTATAGGCAACAATGGACAAATCCATTATGACCATCAAAATGACGGGGCTAGTCAAGCTTTGGCAAGTTGCCAGAGGGACTTCCGCAACAAACCCTATCCTGTCCGAGCAAAGATTACCTATTACCAGAACACACTGACAGTAATGATCAATAATGGCTTTACACCAGATAAAAATGATTATGAATTTTGTGCCAAAGTGGAAAATATGATTATCCCTGCACAAGGGCATTTTGGAATATCTGCTGCAACTGGAGGTCTTGCAGATGACCATGATGTCCTTTCTTTTCTGACTTTCCAGTTGACTGAACCTGGAAAAGAGCCGCCCACACCAGATAAAGAAATTTCGGAAAAGGAAAAAGAAAAGTATCAGGAGGAATTTGAGCACTTTCAACAAGAATTGGATAAAAAAAAAGAGGAATTCCAGAAGGGCCACCCCGACCTCCAAGGGCAGCCTGCGGAGGAAATATTTGAGAGTGTAGGAGATCGAGAGCTAAGACAAGTCTTTGAAGGACAGAATCGTATTCATCTTGAAATCAAGCAGCTGAACCGGCAGTTAGATATGATTCTTGATGAACAGAGAAGATATGTCTCTTCCTTAACAGAGGAAATCTCTAAAAGAGGAGCAGGAATGCCTGGGCAGCATGGGCAGATTACTCAACAAGAACTGGATACTGTTGTGAAAACTCAGCATGAGATTCTGAGACAAGTAAATGAAATGAAAAATTCCATGAGTGAAACCGTCAGACTGGTCAGTGGAATGCAGCACCCTGGCTCTGCTGGAGGCGTCTATGAGACAACACAGCACTTCATTGACATCAAAGAGCACCTGCACATAGTAAAGAGGGACATAGATAACTTAGTGCAGCGAAATATGCCATCAAATGAAAAGCCGAAATGCCCAGAACTACCACCATTTCCATCATGTTTGTCTACGGTCCACTTCATTATATTTGTTGTGGTGCAAACTGTATTATTCATTGGTTATATCATGTATAGGTCTCAGCAAGAAGCAGCTGCCAAAAAATTCTTTTGA-3'
NCBI CDS gene sequence with introns (location: 59331093.. 59359244) (28152 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 59327823.. 59359265) (31443 bp)Download
NCBI gene sequence (location: [59327823.. 59359265 + 1000]) (32443 bp)Download
Cite How to cite