NCBI Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_005118)
C-type lectin domain family 2 member B
C-type lectin domain family 2 member B (Activation-induced C-type lectin) (C-type lectin superfamily member 2) (IFN-alpha-2b-inducing-related protein 1)
CLEC2B
C-type lectin domain family 2 member B
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH
No structure currently available in the PDB RCSB Databank.
Structural models
SWISS-MODEL structural models
The location of the lectin domain structural model is: 31-146
We infer [1.42, 1.78] Å as the interval of error of this structural model.
Template 1: 1K9J chain: A, Q9H2X3, NP_055072.3, sequence identity: 37.9%, coverage: 97.4%, location in sequence: 267-394, (267-394 in PDB).
Template 2: 3ZHG chain: A, Q8CJ91, NP_081248.4, sequence identity: 37.1%, coverage: 100.0%, location in sequence: 191-322, (191-322 in PDB).
Template 3: 1SL4 chain: A, Q9NNX6, NP_066978.1, sequence identity: 36.2%, coverage: 97.4%, location in sequence: 255-382, (255-382 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
We infer [1.42, 1.78] Å as the interval of error of this structural model.
Template 1: 1K9J chain: A, Q9H2X3, NP_055072.3, sequence identity: 37.9%, coverage: 97.4%, location in sequence: 267-394, (267-394 in PDB).
Template 2: 3ZHG chain: A, Q8CJ91, NP_081248.4, sequence identity: 37.1%, coverage: 100.0%, location in sequence: 191-322, (191-322 in PDB).
Template 3: 1SL4 chain: A, Q9NNX6, NP_066978.1, sequence identity: 36.2%, coverage: 97.4%, location in sequence: 255-382, (255-382 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Oligomerization and Known Interactions
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
- Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
- Plasma soluble C-type lectin-like receptor-2 is associated with the risk of coronary artery disease. [31280468]
- Cellular Mechanisms Controlling Surfacing of AICL Glycoproteins, Cognate Ligands of the Activating NK Receptor NKp80. [29980609]
- Physiologic and pathophysiologic roles of interaction between C-type lectin-like receptor 2 and podoplanin: partners from in utero to adulthood. [27960039]
- Vascular Smooth Muscle Cells Stimulate Platelets and Facilitate Thrombus Formation through Platelet CLEC-2: Implications in Atherothrombosis. [26418160]
- Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily. [12945048]
- A sequence-ready physical map of the region containing the human natural killer gene complex on chromosome 12p12.3-p13.2. [10783260]
- C-type lectin-like domains. [10508765]
- Selection of cDNAs encoding putative type II membrane proteins on the cell surface from a human full-length cDNA bank. [10072769]
- AICL: a new activation-induced antigen encoded by the human NK gene complex. [9038101]
UniProt Main References (3 PubMed Identifiers)
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- N-terminome analysis of the human mitochondrial proteome. [25944712]
RNA
RNA (Transcript ID: NM_005127.3)
C-type lectin domain family 2 member B
m7G-5')ppp(5'-GGUAUACCUCUAGUUUGGAGCUGUGCUGUAAAAACAAGAGUAACAUUUUUAUAUUAAAGUUAAAUAAAGUUACAACUUUGAAGAGAGUUUCUGCAAGACAUGACACAAAGCUGCUAGCAGAAAAUCAAAACGCUGAUUAAAAGAAGCACGGUAUGAUGACCAAACAUAAAAAGUGUUUUAUAAUUGUUGGUGUUUUAAUAACAACUAAUAUUAUUACUCUGAUAGUUAAACUAACUCGAGAUUCUCAGAGUUUAUGCCCCUAUGAUUGGAUUGGUUUCCAAAACAAAUGCUAUUAUUUCUCUAAAGAAGAAGGAGAUUGGAAUUCAAGUAAAUACAACUGUUCCACUCAACAUGCCGACCUAACUAUAAUUGACAACAUAGAAGAAAUGAAUUUUCUUAGGCGGUAUAAAUGCAGUUCUGAUCACUGGAUUGGACUGAAGAUGGCAAAAAAUCGAACAGGACAAUGGGUAGAUGGAGCUACAUUUACCAAAUCGUUUGGCAUGAGAGGGAGUGAAGGAUGUGCCUACCUCAGCGAUGAUGGUGCAGCAACAGCUAGAUGUUACACCGAAAGAAAAUGGAUUUGCAGGAAAAGAAUACACUAAGUUAAUGUCUAAGAUAAUGGGGAAAAUAGAAAAUAACAUUAUUAAGUGUAAAACCAGCAAAGUACUUUUUUAAUUAAACAAAGUUCGAGUUUUGUACCUGUCUGGUUAAUUCUGCUUACGUGUCAGGCUACACAUAAAAGCCACUUCAAAGAUUGGCAAAAAAUGGUUACAGGUAUUCUGCUGAGUUUUUUUCUUUCUUUCUUUCUCUCUCUCUCUUUCUUUCUUUCUUUCUUUCUUUCUUUUUUUAACUGUAAACCAGAAAACAAUUGUGGGGAUCAAGGACAGACAUAGCACUUAGACAGGACUUUCAUGACCCAAUAUGGAACAAUUUGAGUACCAGAAUAGGAGAUUAUGGCCUAUUGAACAAAAUGUGAAACUGGGAGUCCACAAAGACAUAAAUGGAAAGAUGAAGUACCUCCUGACAGAGCAAGAAUGGCACUGAACAAUGUUAUAUGGACAAUGGCUAUUUUAUUCAAGACUAUUACAAUAGGGAAAAGAGACUAGGACUCAGUCUGAACUGAAAUCUGUCAAAACAAAGGGGGGUGGGGCUUUAAGAGUGAAGGUGAGGAGGAGAUCACACACCGUAUGUGUUUGCUAACUGGCUUUACCCAAAAGAAAAUUAAACUUUCUUUGAUCUGUACAAGUUGAUCAAACAAAUGGGGUCAUUCUUGUCAUAUGCAACUAAAACAGGGUAGACAGGCCAGGGGAAAAAGGCACUCAGGGCACACAGCAUUGCUUCAAAAUAUAAUUCUCUACAAACCUAGUUGCUAAAACUACCUGUUGUAACCUAAAACCAGUUUUAUCUAACAGCUAUUAAAACAACCUACUGUGACUGCAAAACUGGUUUUACCCACCACUGUCACACACCAAUCAGAACUUGCCAGCUCCUCAAAACUUUACUAGGGCCAAUAAACUUUCUUUCAAAACAAUA-3'- Poly-A tail - Coding region
DNA
DNA (Gene ID: 9976)
C-type lectin domain family 2 member B
strand -
AICL, HP10085
NCBI CDS gene sequence (450 bp)
5'-ATGATGACCAAACATAAAAAGTGTTTTATAATTGTTGGTGTTTTAATAACAACTAATATTATTACTCTGATAGTTAAACTAACTCGAGATTCTCAGAGTTTATGCCCCTATGATTGGATTGGTTTCCAAAACAAATGCTATTATTTCTCTAAAGAAGAAGGAGATTGGAATTCAAGTAAATACAACTGTTCCACTCAACATGCCGACCTAACTATAATTGACAACATAGAAGAAATGAATTTTCTTAGGCGGTATAAATGCAGTTCTGATCACTGGATTGGACTGAAGATGGCAAAAAATCGAACAGGACAATGGGTAGATGGAGCTACATTTACCAAATCGTTTGGCATGAGAGGGAGTGAAGGATGTGCCTACCTCAGCGATGATGGTGCAGCAACAGCTAGATGTTACACCGAAAGAAAATGGATTTGCAGGAAAAGAATACACTAA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.