NCBI Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_005118)
C-type lectin domain family 2 member B
C-type lectin domain family 2 member B (Activation-induced C-type lectin) (C-type lectin superfamily member 2) (IFN-alpha-2b-inducing-related protein 1)
CLEC2B
C-type lectin domain family 2 member B
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
Uncharacterised
0.322
Undefined
Protein sequence and protein families (fasta) (149 amino acids) Download
MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.42, 1.78] ÅDownload
The location of the lectin domain structural model is: 31-146
We infer [1.42, 1.78] Å as the interval of error of this structural model.
Template 1: 1K9J chain: A, Q9H2X3, NP_055072.3, sequence identity: 37.9%, coverage: 97.4%, location in sequence: 267-394, (267-394 in PDB).
Template 2: 3ZHG chain: A, Q8CJ91, NP_081248.4, sequence identity: 37.1%, coverage: 100.0%, location in sequence: 191-322, (191-322 in PDB).
Template 3: 1SL4 chain: A, Q9NNX6, NP_066978.1, sequence identity: 36.2%, coverage: 97.4%, location in sequence: 255-382, (255-382 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Oligomerization and Known Interactions
Homodimer (PubMed:29980609). Interacts with NKp80/KLRF1 (PubMed:17057721)
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
  • Plasma soluble C-type lectin-like receptor-2 is associated with the risk of coronary artery disease. [31280468]
  • Cellular Mechanisms Controlling Surfacing of AICL Glycoproteins, Cognate Ligands of the Activating NK Receptor NKp80. [29980609]
  • Physiologic and pathophysiologic roles of interaction between C-type lectin-like receptor 2 and podoplanin: partners from in utero to adulthood. [27960039]
  • Vascular Smooth Muscle Cells Stimulate Platelets and Facilitate Thrombus Formation through Platelet CLEC-2: Implications in Atherothrombosis. [26418160]
  • Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily. [12945048]
  • A sequence-ready physical map of the region containing the human natural killer gene complex on chromosome 12p12.3-p13.2. [10783260]
  • C-type lectin-like domains. [10508765]
  • Selection of cDNAs encoding putative type II membrane proteins on the cell surface from a human full-length cDNA bank. [10072769]
  • AICL: a new activation-induced antigen encoded by the human NK gene complex. [9038101]
UniProt Main References (3 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • N-terminome analysis of the human mitochondrial proteome. [25944712]
RNA
RNA (Transcript ID: NM_005127.3)
C-type lectin domain family 2 member B
m7G-5')ppp(5'-GGUAUACCUCUAGUUUGGAGCUGUGCUGUAAAAACAAGAGUAACAUUUUUAUAUUAAAGUUAAAUAAAGUUACAACUUUGAAGAGAGUUUCUGCAAGACAUGACACAAAGCUGCUAGCAGAAAAUCAAAACGCUGAUUAAAAGAAGCACGGUAUGAUGACCAAACAUAAAAAGUGUUUUAUAAUUGUUGGUGUUUUAAUAACAACUAAUAUUAUUACUCUGAUAGUUAAACUAACUCGAGAUUCUCAGAGUUUAUGCCCCUAUGAUUGGAUUGGUUUCCAAAACAAAUGCUAUUAUUUCUCUAAAGAAGAAGGAGAUUGGAAUUCAAGUAAAUACAACUGUUCCACUCAACAUGCCGACCUAACUAUAAUUGACAACAUAGAAGAAAUGAAUUUUCUUAGGCGGUAUAAAUGCAGUUCUGAUCACUGGAUUGGACUGAAGAUGGCAAAAAAUCGAACAGGACAAUGGGUAGAUGGAGCUACAUUUACCAAAUCGUUUGGCAUGAGAGGGAGUGAAGGAUGUGCCUACCUCAGCGAUGAUGGUGCAGCAACAGCUAGAUGUUACACCGAAAGAAAAUGGAUUUGCAGGAAAAGAAUACACUAAGUUAAUGUCUAAGAUAAUGGGGAAAAUAGAAAAUAACAUUAUUAAGUGUAAAACCAGCAAAGUACUUUUUUAAUUAAACAAAGUUCGAGUUUUGUACCUGUCUGGUUAAUUCUGCUUACGUGUCAGGCUACACAUAAAAGCCACUUCAAAGAUUGGCAAAAAAUGGUUACAGGUAUUCUGCUGAGUUUUUUUCUUUCUUUCUUUCUCUCUCUCUCUUUCUUUCUUUCUUUCUUUCUUUCUUUUUUUAACUGUAAACCAGAAAACAAUUGUGGGGAUCAAGGACAGACAUAGCACUUAGACAGGACUUUCAUGACCCAAUAUGGAACAAUUUGAGUACCAGAAUAGGAGAUUAUGGCCUAUUGAACAAAAUGUGAAACUGGGAGUCCACAAAGACAUAAAUGGAAAGAUGAAGUACCUCCUGACAGAGCAAGAAUGGCACUGAACAAUGUUAUAUGGACAAUGGCUAUUUUAUUCAAGACUAUUACAAUAGGGAAAAGAGACUAGGACUCAGUCUGAACUGAAAUCUGUCAAAACAAAGGGGGGUGGGGCUUUAAGAGUGAAGGUGAGGAGGAGAUCACACACCGUAUGUGUUUGCUAACUGGCUUUACCCAAAAGAAAAUUAAACUUUCUUUGAUCUGUACAAGUUGAUCAAACAAAUGGGGUCAUUCUUGUCAUAUGCAACUAAAACAGGGUAGACAGGCCAGGGGAAAAAGGCACUCAGGGCACACAGCAUUGCUUCAAAAUAUAAUUCUCUACAAACCUAGUUGCUAAAACUACCUGUUGUAACCUAAAACCAGUUUUAUCUAACAGCUAUUAAAACAACCUACUGUGACUGCAAAACUGGUUUUACCCACCACUGUCACACACCAAUCAGAACUUGCCAGCUCCUCAAAACUUUACUAGGGCCAAUAAACUUUCUUUCAAAACAAUA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 9976)
C-type lectin domain family 2 member B
strand -
AICL, HP10085
NCBI CDS gene sequence (450 bp)
5'-ATGATGACCAAACATAAAAAGTGTTTTATAATTGTTGGTGTTTTAATAACAACTAATATTATTACTCTGATAGTTAAACTAACTCGAGATTCTCAGAGTTTATGCCCCTATGATTGGATTGGTTTCCAAAACAAATGCTATTATTTCTCTAAAGAAGAAGGAGATTGGAATTCAAGTAAATACAACTGTTCCACTCAACATGCCGACCTAACTATAATTGACAACATAGAAGAAATGAATTTTCTTAGGCGGTATAAATGCAGTTCTGATCACTGGATTGGACTGAAGATGGCAAAAAATCGAACAGGACAATGGGTAGATGGAGCTACATTTACCAAATCGTTTGGCATGAGAGGGAGTGAAGGATGTGCCTACCTCAGCGATGATGGTGCAGCAACAGCTAGATGTTACACCGAAAGAAAATGGATTTGCAGGAAAAGAATACACTAA-3'
NCBI CDS gene sequence with introns (location: 9853300.. 9862571) (9272 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 9852369.. 9869354) (16986 bp)Download
NCBI gene sequence (location: [9852369.. 9869354 + 1000]) (17986 bp)Download
Cite How to cite