NCBI Summary
This gene encodes a member of the glycosyltransferase 2 protein family. Members of this family initiate mucin-type O-glycoslation of peptides in the Golgi apparatus. The encoded protein may be involved in O-linked glycosylation of the immunoglobulin A1 hinge region. This gene may influence triglyceride levels, and may be involved Type 2 diabetes, as well as several types of cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014].
Protein
Protein (NP_004472)
CBM13-ppGalNAc-T2
Polypeptide N-acetylgalactosaminyltransferase 2 (EC 2.4.1.41) (Polypeptide GalNAc transferase 2) (GalNAc-T2) (pp-GaNTase 2) (Protein-UDP acetylgalactosaminyltransferase 2) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 2 soluble form]
GALNT2
polypeptide N-acetylgalactosaminyltransferase 2
Undefined
Curated
Ricin-like
R-Type Lectins
b-trefoil
0.217
Protein sequence and protein families (fasta) (571 amino acids) Download
MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
Glycopeptide with one GalNAc, glycopeptide
GalNAc
References
NCBI References (10 PubMed Identifiers)
  • GALNT2/14 overexpression correlate with prognosis and methylation: potential therapeutic targets for lung adenocarcinoma. [33964375]
  • GALNT2 promotes cell proliferation, migration, and invasion by activating the Notch/Hes1-PTEN-PI3K/Akt signaling pathway in lung adenocarcinoma. [33785338]
  • TLR7 in B cells promotes renal inflammation and Gd-IgA1 synthesis in IgA nephropathy. [32699192]
  • Novel congenital disorder of O-linked glycosylation caused by GALNT2 loss of function. [32293671]
  • A reference map of the human binary protein interactome. [32296183]
  • Localization of three human polypeptide GalNAc-transferases in HeLa cells suggests initiation of O-linked glycosylation throughout the Golgi apparatus. [9394011]
  • Localization of O-glycosylation sites on glycopeptide fragments from lactation-associated MUC1. All putative sites within the tandem repeat are glycosylation targets in vivo. [9312074]
  • Substrate specificities of three members of the human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase family, GalNAc-T1, -T2, and -T3. [9295285]
  • cDNA cloning and expression of a novel human UDP-N-acetyl-alpha-D-galactosamine. Polypeptide N-acetylgalactosaminyltransferase, GalNAc-t3. [8663203]
  • Purification and cDNA cloning of a human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase. [7592619]
UniProt Main References (12 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Initiation of O-glycan synthesis in IgA1 hinge region is determined by a single enzyme, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2. [12438318]
  • Initial characterization of the human central proteome. [21269460]
  • Toward a comprehensive characterization of a human cancer cell phosphoproteome. [23186163]
  • An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. [24275569]
  • N-terminome analysis of the human mitochondrial proteome. [25944712]
  • Dynamic association between the catalytic and lectin domains of human UDP-GalNAc:polypeptide alpha-N-acetylgalactosaminyltransferase-2. [16434399]
  • Substrate-guided front-face reaction revealed by combined structural snapshots and metadynamics for the polypeptide N-acetylgalactosaminyltransferase 2. [24954443]
  • Show more
All isoforms of this gene containing a lectin domain
NP_001278795.1, NP_004472.1
RNA
RNA (Transcript ID: NM_004481.5)
polypeptide N-acetylgalactosaminyltransferase 2, transcript variant 1
m7G-5')ppp(5'-ACUCGCGAGCAGCGGCGGCCCCGCCGGCGGCCGAGUUGGGAGAAUGCGGCGGCGCUCGCGGAUGCUGCUCUGCUUCGCCUUCCUGUGGGUGCUGGGCAUCGCCUACUACAUGUACUCGGGGGGCGGCUCUGCGCUGGCCGGGGGCGCGGGCGGCGGCGCCGGCAGGAAGGAGGACUGGAAUGAAAUUGACCCCAUUAAAAAGAAAGACCUUCAUCACAGCAAUGGAGAAGAGAAAGCACAAAGCAUGGAGACCCUCCCUCCAGGGAAAGUACGGUGGCCAGACUUUAACCAGGAAGCUUAUGUUGGAGGGACGAUGGUCCGCUCCGGGCAGGACCCUUACGCCCGCAACAAGUUCAACCAGGUGGAGAGUGAUAAGCUUCGAAUGGACAGAGCCAUCCCUGACACCCGGCAUGACCAGUGUCAGCGGAAGCAGUGGCGGGUGGAUCUGCCGGCCACCAGCGUGGUGAUCACGUUUCACAAUGAAGCCAGGUCGGCCCUACUCAGGACCGUGGUCAGCGUGCUUAAGAAAAGCCCGCCCCAUCUCAUAAAAGAAAUCAUCUUGGUGGAUGACUACAGCAAUGAUCCUGAGGACGGGGCUCUCUUGGGGAAAAUUGAGAAAGUGCGAGUUCUUAGAAAUGAUCGACGAGAAGGCCUCAUGCGCUCACGGGUUCGGGGGGCCGAUGCUGCCCAAGCCAAGGUCCUGACCUUCCUGGACAGUCACUGCGAGUGUAAUGAGCACUGGCUGGAGCCCCUCCUGGAAAGGGUGGCGGAGGACAGGACUCGGGUUGUGUCACCCAUCAUCGAUGUCAUUAAUAUGGACAACUUUCAGUAUGUGGGGGCAUCUGCUGACUUGAAGGGCGGUUUUGAUUGGAACUUGGUAUUCAAGUGGGAUUACAUGACGCCUGAGCAGAGAAGGUCCCGGCAGGGGAACCCAGUCGCCCCUAUAAAAACCCCCAUGAUUGCUGGUGGGCUGUUUGUGAUGGAUAAGUUCUAUUUUGAAGAACUGGGGAAGUACGACAUGAUGAUGGAUGUGUGGGGAGGAGAGAACCUAGAGAUCUCGUUCCGCGUGUGGCAGUGUGGUGGCAGCCUGGAGAUCAUCCCGUGCAGCCGUGUGGGACACGUGUUCCGGAAGCAGCACCCCUACACGUUCCCGGGUGGCAGUGGCACUGUCUUUGCCCGAAACACCCGCCGGGCAGCAGAGGUCUGGAUGGAUGAAUACAAAAAUUUCUAUUAUGCAGCAGUGCCUUCUGCUAGAAACGUUCCUUAUGGAAAUAUUCAGAGCAGAUUGGAGCUUAGGAAGAAACUCAGCUGCAAGCCUUUCAAAUGGUACCUUGAAAAUGUCUAUCCAGAGUUAAGGGUUCCAGACCAUCAGGAUAUAGCUUUUGGGGCCUUGCAGCAGGGAACUAACUGCCUCGACACUUUGGGACACUUUGCUGAUGGUGUGGUUGGAGUUUAUGAAUGUCACAAUGCUGGGGGAAACCAGGAAUGGGCCUUGACGAAGGAGAAGUCGGUGAAGCACAUGGAUUUGUGCCUUACUGUGGUGGACCGGGCACCGGGCUCUCUUAUAAAGCUGCAGGGCUGCCGAGAAAAUGACAGCAGACAGAAAUGGGAACAGAUCGAGGGCAACUCCAAGCUGAGGCACGUGGGCAGCAACCUGUGCCUGGACAGUCGCACGGCCAAGAGCGGGGGCCUAAGCGUGGAGGUGUGUGGCCCGGCCCUUUCGCAGCAGUGGAAGUUCACGCUCAACCUGCAGCAGUAGGAGGGUCCGGGAGGCCCUGCCGUCCUGUCUCCUGCACCAUUGGGUGGAGUCUGGUGAUCACAUUAUUGAUUAUGUUUCUUAAACUUUCCGCGAAACUAAUAUACCUCAGUAUUCCAUCAUGGUCUGAAAGUCAAACUUCGGCAAGGCACGGACGACUGUGCAGACACAGCAGCGGCAAGAAGCGAGAACUGCCCUCCCCCUCCUCUCGGUGCAGCCCAGCCGGGCCCCCUUCCCCAGGCCGGAGCGCCCCUCUUCCUUCCAGCUUUCACUUCUGCCGGCUCCGCAACUGAGUGACACCCAGCGACAACCGACUGGGGAGUGGUAGAAGCAACUGAACGGAUGCGUGCGAGCUGAGGACAGGGCGGGAGGAGGGGGCACACAUGCCCCAGGGGAGCGAGGAGAACUCUUGAAAUCUCCAUUUUCAAUCCCUUCGAAAUCACGUAUGGUUUCCACAAAGCCGAGUCGUGUCACGUGGCAGGUUUACGUCAAUAGUCCCUCUCUCUGCUCCUCCAUUCGCAAGUGUCUUCCUGGGCCAGACUCCCCUCCACCUCAUGUACUUGCUAUAUUGAGGAUGAAGUUUUCUAUGGUGGGACACUAAAUAUAAAGCUAUAUAGAGAAAGAAUGUACGGUCAGUUCCCUAUGGUUUCUGUAGAUCAUCGUCAUCUUGUAUAUUCCCCACAAAGCCGUUCGCAGCUUCCGGGAGAAGGGGCCAGAGCCCGGUGGGGCCAGUUUCUCACAGAGGGAGGAGGUGGCCUUUGUCCCCUGGAGCCCGAUCAGCCAGUUGGUGCUACUGCUGUGGCCAGCUGGGGGGCUUCCUCCAGACCACCGGCCUCGGCCCCGGCAUCCCUGUUGGGCGUCAGCCUGAGAGUCCCUACUGUGCGUCAGAAUCCACCUUGCGUGCUGUGCGUAUCUGUGAACCUGGAGCGGUUACUUAUUUUGACAGAUAUCACUUUGGGUCUUUUUACAUUAAAUUUCUUUUCUCUAAGGAAUAUAAGACAUACCCCAUAGCUCUGUGUGAGCCAGCAAUACCGCUGCCCCCUGGCGACAGGGCAGACCAAUGAUGCCAGGCAGCUGUCACACGCUAGUAUUGGCUUCAUUGUGAUCUGAGCCCUGCACGCUGGGCCUUCAGAAUUAAUGGCCAGCAGUGUCAGGGAUGAGCCCGUCAGCCAGGGCACAGGCCUGGCUCACAGUCCUGCACACCUGCUGGCCUGGGGAGCUCCAGCCAGGCAGCGAGUCCUGCCCCGCCCGCAGCUCCCUCCCACACCCCGCCUGGCCAAGAUGACUGCUUCAGGGGGCUUUGGGGAAAGAAUUAGGAAGGGUCAGAACCAAACAAUACCUGCUCAUUUACACUGAGGAUUCAGGGCGGGAGACAGGAGCCUUGGGGUCCUGUUAAACCACAGACAGUUAUGAACUGAAAGUCAUAACGGGGAGAGGUGCCUGGCUUCUACCUGGGUGCUCAGGAAUGUUCCUCGUCACCCCUGCCACUCUGUGGUCGGUGCCCUGCUUCCUCCUCCACUCCUGGCCGCCUUCUCCAGCGCCGCACACACAGAUGCUCAGUCUCAGAGAGGCUGGCACGGCCUGGCAGUCUGAGAAAAGCGUCAGUUAGGCACACCUGCAGGCCCCUCGGUGGGACAGCGGCGGCCUUGGAGUUAGGAGCCACCCUGGGAGGUUGUGCCGGUGCCAUGCUCCUCCCUGUGUCUUGUAUGAAAGGGGCCACUGUGUGUCUUCCUCCCCGGCGGGAGCCCCACAUGUGUGCACUGUAGGACAGCGGCCCCGAGGUGGAAGCCUGGCUGGAGGGCUGCCCUAUAGGUCUUCUCUUCCCGCCUCCCCUGCCAUGCAACCAGAUGUGUUGUGAGUGGGCAGCGUGCCCCCACGCUGGAGUAACUCCGCACGCUUCUGUCUUUCACGGUGGGCGCUCGGGGGGAGCCUGAGGAAAACCCCCUUAGGUACCUGUGCGAGGCUGUGGAGUGCAGGCCAGAGCAGGGUGUGCGUAGCCCCCAGCACCCAGGUUCUUCUGUCAGACCCUGUGACCUGCGAGCUGCUACUACUGUAAGGAGGGAAAUGGAUGAAUCUGGCUCGUUUUAAAAUCACGUUUUCUGACGAAUCCUUUGCCCCUUCACCUUUACCCCGCCCGCACCCCUAGGCCCUCUCAGCCUUCCUAUCAUCCCACGUGUCUACCCAGACCCUUGUGCGGCCCAUGCCCUGGGGGCGGCGUCCUGUCCCUGAGCUGGGAGGCGGCUUUGGAUGGUCCGGGCGUCAAGAGCAGGGGUGGGCCGGGGAGGGGUCCUUUGCGGUGAGCUAUGUUUACAUGACACAGUGUGCCAAAGUGACUUACUGCGGUUGCGUUAGUUUUUAAUCAUCAGGACUAUCUCACCCUCCCACUCCUGUUUUUAAAACUCAGAAUUCUUUCCUAAGAGCCCUUCGAGCAAAGCGUGCCGAAGUUAGUUGUCUUCUCUGUGCUGGUCCUUUCUUAUGUCCUCAUAAAAGCUCAGAUGAUGGUAUCUGUGAGUAUGUUUUGCAAAUUCAAAAUAUAGUUUGGUAAUUUUUUUUUCCAGUUGAUUUUUAAAAAGAACUGCUGUACAGAGCUUGUACUUUGUCCAUUUUAUAGAUGGAAACCAUCCUUGAAAAUUGUUUAACUUAAAUAAAGAGAAGAUACUUUCUAGA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 2590)
polypeptide N-acetylgalactosaminyltransferase 2
strand +
GalNAc-T2
NCBI CDS gene sequence (1716 bp)
5'-ATGCGGCGGCGCTCGCGGATGCTGCTCTGCTTCGCCTTCCTGTGGGTGCTGGGCATCGCCTACTACATGTACTCGGGGGGCGGCTCTGCGCTGGCCGGGGGCGCGGGCGGCGGCGCCGGCAGGAAGGAGGACTGGAATGAAATTGACCCCATTAAAAAGAAAGACCTTCATCACAGCAATGGAGAAGAGAAAGCACAAAGCATGGAGACCCTCCCTCCAGGGAAAGTACGGTGGCCAGACTTTAACCAGGAAGCTTATGTTGGAGGGACGATGGTCCGCTCCGGGCAGGACCCTTACGCCCGCAACAAGTTCAACCAGGTGGAGAGTGATAAGCTTCGAATGGACAGAGCCATCCCTGACACCCGGCATGACCAGTGTCAGCGGAAGCAGTGGCGGGTGGATCTGCCGGCCACCAGCGTGGTGATCACGTTTCACAATGAAGCCAGGTCGGCCCTACTCAGGACCGTGGTCAGCGTGCTTAAGAAAAGCCCGCCCCATCTCATAAAAGAAATCATCTTGGTGGATGACTACAGCAATGATCCTGAGGACGGGGCTCTCTTGGGGAAAATTGAGAAAGTGCGAGTTCTTAGAAATGATCGACGAGAAGGCCTCATGCGCTCACGGGTTCGGGGGGCCGATGCTGCCCAAGCCAAGGTCCTGACCTTCCTGGACAGTCACTGCGAGTGTAATGAGCACTGGCTGGAGCCCCTCCTGGAAAGGGTGGCGGAGGACAGGACTCGGGTTGTGTCACCCATCATCGATGTCATTAATATGGACAACTTTCAGTATGTGGGGGCATCTGCTGACTTGAAGGGCGGTTTTGATTGGAACTTGGTATTCAAGTGGGATTACATGACGCCTGAGCAGAGAAGGTCCCGGCAGGGGAACCCAGTCGCCCCTATAAAAACCCCCATGATTGCTGGTGGGCTGTTTGTGATGGATAAGTTCTATTTTGAAGAACTGGGGAAGTACGACATGATGATGGATGTGTGGGGAGGAGAGAACCTAGAGATCTCGTTCCGCGTGTGGCAGTGTGGTGGCAGCCTGGAGATCATCCCGTGCAGCCGTGTGGGACACGTGTTCCGGAAGCAGCACCCCTACACGTTCCCGGGTGGCAGTGGCACTGTCTTTGCCCGAAACACCCGCCGGGCAGCAGAGGTCTGGATGGATGAATACAAAAATTTCTATTATGCAGCAGTGCCTTCTGCTAGAAACGTTCCTTATGGAAATATTCAGAGCAGATTGGAGCTTAGGAAGAAACTCAGCTGCAAGCCTTTCAAATGGTACCTTGAAAATGTCTATCCAGAGTTAAGGGTTCCAGACCATCAGGATATAGCTTTTGGGGCCTTGCAGCAGGGAACTAACTGCCTCGACACTTTGGGACACTTTGCTGATGGTGTGGTTGGAGTTTATGAATGTCACAATGCTGGGGGAAACCAGGAATGGGCCTTGACGAAGGAGAAGTCGGTGAAGCACATGGATTTGTGCCTTACTGTGGTGGACCGGGCACCGGGCTCTCTTATAAAGCTGCAGGGCTGCCGAGAAAATGACAGCAGACAGAAATGGGAACAGATCGAGGGCAACTCCAAGCTGAGGCACGTGGGCAGCAACCTGTGCCTGGACAGTCGCACGGCCAAGAGCGGGGGCCTAAGCGTGGAGGTGTGTGGCCCGGCCCTTTCGCAGCAGTGGAAGTTCACGCTCAACCTGCAGCAGTAG-3'
NCBI CDS gene sequence with introns (location: 230067281.. 230279458) (212178 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 230067238.. 230282122) (214885 bp)Download
NCBI gene sequence (location: [230067238 - 1000].. 230282122) (215885 bp)Download
Cite How to cite