NCBI Summary
The protein encoded by this gene is a type II membrane receptor with an extracellular C-type lectin-like domain fold. The extracellular portion binds structures with a high mannose content and has been shown to recognize several pathogens, including C. elegans, S. cerevisiae, M. tuberculosis, C. neoformans, and house dust mite. When stimulated, the encoded protein initiates signalling through the CARD9-Bcl10-Malt1 pathway, leading to the induction of cytokines. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015].
Protein
Protein (NP_001007034)
Dectin-2
C-type lectin domain family 6 member A (C-type lectin superfamily member 10) (Dendritic cell-associated C-type lectin 2) (DC-associated C-type lectin 2) (Dectin-2)
CLEC6A
C-type lectin domain containing 6A
Undefined
Curated
C-type lectin
CLEC4N
C-type - Type II transmembrane receptors
a/b mixed / C-type lectin-like
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
Mol* PDB structure viewerUniLectin3D
Oligomerization and Known Interactions
Associated with FCER1G (By similarity). Heterodimer with CLEC4D; this heterodimer forms a pattern recognition receptor (PRR) against fungal infection (PubMed:23911656)
Annotation
Ligand
Glycan ligands from structural data
Man(a1-3)[Man(a1-2)Man(a1-6)]Man.png)
aMan12aMan13(aMan12aMan16)bMan
Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man
References
NCBI References (10 PubMed Identifiers)
- Deletion of haematopoietic Dectin-2 or CARD9 does not protect from atherosclerosis development under hyperglycaemic conditions. [31868000]
- Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. [31371767]
- Deciphering the molecular basis of mycobacteria and lipoglycan recognition by the C-type lectin Dectin-2. [30443026]
- Dectin-1/2-induced autocrine PGE2 signaling licenses dendritic cells to prime Th2 responses. [29668708]
- The Syk-Coupled C-Type Lectin Receptors Dectin-2 and Dectin-3 Are Involved in Paracoccidioides brasiliensis Recognition by Human Plasmacytoid Dendritic Cells. [29616019]
- The carbohydrate-recognition domain of Dectin-2 is a C-type lectin with specificity for high mannose. [16423983]
- Identification and expression profiling of a human C-type lectin, structurally homologous to mouse dectin-2. [15810886]
- Identification of lectin-like receptors expressed by antigen presenting cells and neutrophils and their mapping to a novel gene complex. [15368084]
- Molecular cloning of human dectin-2. [15175046]
- Signaling and immune regulatory role of the dendritic cell immunoreceptor (DCIR) family lectins: DCIR, DCAR, dectin-2 and BDCA-2. [15481152]
UniProt Main References (4 PubMed Identifiers)
- The finished DNA sequence of human chromosome 12. [16541075]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- C-type lectin receptors Dectin-3 and Dectin-2 form a heterodimeric pattern-recognition receptor for host defense against fungal infection. [23911656]
- Mechanism of pathogen recognition by human dectin-2. [28652405]
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_001007033.2)
C-type lectin domain containing 6A, transcript variant 1
m7G-5')ppp(5'-AAUGUUGGAAGUCUCUUAGUCCUAUAAGAGUGUGUAGCAGUUUGUCCCUGAGCUCUAGCUUCUUUAAAUGAAGCUGAGUCUCUGGGCAACAUCUUUAGGGAGAGAGGUACAAAAGGUUCCUGGACCUUCUCAACACAGGGAGCCUGCAUAAUGAUGCAAGAGCAGCAACCUCAAAGUACAGAGAAAAGAGGCUGGUUGUCCCUGAGACUCUGGUCUGUGGCUGGGAUUUCCAUUGCACUCCUCAGUGCUUGCUUCAUUGUGAGCUGUGUAGUAACUUACCAUUUUACAUAUGGUGAAACUGGCAAAAGGCUGUCUGAACUACACUCAUAUCAUUCAAGUCUCACCUGCUUCAGUGAAGGGACAAAGGUGCCAGCCUGGGGAUGUUGCCCAGCUUCUUGGAAGUCAUUUGGUUCCAGUUGCUACUUCAUUUCCAGUGAAGAGAAGGUUUGGUCUAAGAGUGAGCAGAACUGUGUUGAGAUGGGAGCACAUUUGGUUGUGUUCAACACAGAAGCAGAGCAGAAUUUCAUUGUCCAGCAGCUGAAUGAGUCAUUUUCUUAUUUUCUGGGGCUUUCAGACCCACAAGGUAAUAAUAAUUGGCAAUGGAUUGAUAAGACACCUUAUGAGAAAAAUGUCAGAUUUUGGCACCUAGGUGAGCCCAAUCAUUCUGCAGAGCAAUGUGCUUCAAUAGUCUUCUGGAAACCUACAGGAUGGGGCUGGAAUGAUGUUAUCUGUGAAACUAGAAGGAAUUCAAUAUGUGAGAUGAAUAAGAUUUACCUAUGAGUAGAAGCUUAAUUGGAAAGAAGAGAAGAAUUACUGACGUAAUUUUUUCCCUGACGUCUUUAAAAUUGAACCCUAUCAUGAAAUGAUAAUUUCUUCCUGAAUUUACACAUAAUCCUUAUGUUAUAGAGGUUCACAGAAAUGGAAAGAUACCUGUUUCCCUUUAAUCAAUCUUCUCGUUUCCUCUUUUCCAUUAAUGAUAGAAUGCACCCUUCCUCUCUUUGUUCCAUUCUUUCACUUGUUAUUCAUUUUUUUCUUUCUUCACACUUCAUUACACAAAUAUUUAUUGUUUCAGAGACUGUACUAUUUUGUUUGUUAGAAGAUUUAUAAGGCAGUAUCUUUUGAAAAUUAUGACUUUCCUUCCUCAAUAUACCAUAAAGAAAUCUUUUUGGUCAAGAUGGUAGUUGGAACUACAAUCAUCUGAAGGCCUGACAAGAGUUGAAAGACAUGUUUUCUAGAUGGCUCACUCACAUGGCUGGCAACUUGGUGUUGGCUAUUAAUGUAACCUGGAAAUAAAUUUUAUUCUGCAGUUAGGGAUUUGGCAUUUUAUAUAUGUUGAUUCAAUCAAGUUUGGCAAGCAGGGUGUUCGAUACUGCUAUAUCCUGUAUUCUUGGUUUAUUUGUUUUAUUUCUGAGAAAUAUGUGUUAAGAUCUCUCGCUGAUUGGGAAUUUGUCUAUUUCUCAUUUAAAUUUUGUCAAAUCUUUCUUUGCUUGCAAGCAUUUCUUGUUACCCAAAUCUAAUCUAUUCCUGAAAAUAUGAUGGUUAGCAAAGUUUGAGAUAACUAGAGCCUGUAAUCCAUCAUUUUAAAUGGCAAUGAUAAUGACAGUUUAUUUUUAUGUUAUAUAAAAACCUCAACAAAUUUUCCAAAC-3'- Poly-A tail - Coding region
DNA
DNA (Gene ID: 93978)
C-type lectin domain containing 6A
strand +
dectin-2, hDECTIN-2
NCBI CDS gene sequence (630 bp)
5'-ATGATGCAAGAGCAGCAACCTCAAAGTACAGAGAAAAGAGGCTGGTTGTCCCTGAGACTCTGGTCTGTGGCTGGGATTTCCATTGCACTCCTCAGTGCTTGCTTCATTGTGAGCTGTGTAGTAACTTACCATTTTACATATGGTGAAACTGGCAAAAGGCTGTCTGAACTACACTCATATCATTCAAGTCTCACCTGCTTCAGTGAAGGGACAAAGGTGCCAGCCTGGGGATGTTGCCCAGCTTCTTGGAAGTCATTTGGTTCCAGTTGCTACTTCATTTCCAGTGAAGAGAAGGTTTGGTCTAAGAGTGAGCAGAACTGTGTTGAGATGGGAGCACATTTGGTTGTGTTCAACACAGAAGCAGAGCAGAATTTCATTGTCCAGCAGCTGAATGAGTCATTTTCTTATTTTCTGGGGCTTTCAGACCCACAAGGTAATAATAATTGGCAATGGATTGATAAGACACCTTATGAGAAAAATGTCAGATTTTGGCACCTAGGTGAGCCCAATCATTCTGCAGAGCAATGTGCTTCAATAGTCTTCTGGAAACCTACAGGATGGGGCTGGAATGATGTTATCTGTGAAACTAGAAGGAATTCAATATGTGAGATGAATAAGATTTACCTATGA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.