Protein
Protein (NP_003269)
Tetranectin
Tetranectin (TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein)
CLEC3B
C-type lectin domain family 3 member B
Undefined
Curated
C-type lectin
CLEC3B
C-type - Tetranectin
a/b mixed / C-type lectin-like
Heparin
0.418
Protein sequence and protein families (fasta) (202 amino acids) Download
MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • CLEC3B p.S106G Mutant in a Caucasian Population of Successful Neurological Aging. [31570938]
  • CLEC3B protects H9c2 cardiomyocytes from apoptosis caused by hypoxia via the PI3K/Akt pathway. [32696821]
  • Downregulation of exosomal CLEC3B in hepatocellular carcinoma promotes metastasis and angiogenesis via AMPK and VEGF signals. [31477130]
  • The In Vitro Biotransformation of the Fusion Protein Tetranectin-Apolipoprotein A1. [30858459]
  • CLEC3B is downregulated and inhibits proliferation in clear cell renal cell carcinoma. [30066941]
  • The gene structure of tetranectin, a plasminogen binding protein. [1511740]
  • Tetranectin, a plasminogen kringle 4-binding protein. Cloning and gene expression pattern in human colon cancer. [1354271]
  • Identification of a highly mobilizable subset of human neutrophil intracellular vesicles that contains tetranectin and latent alkaline phosphatase. [2298916]
  • Interaction of tetranectin with sulphated polysaccharides and trypan blue. [2533389]
  • Purification and characterization of a novel, oligomeric, plasminogen kringle 4 binding protein from human plasma: tetranectin. [3009181]
UniProt Main References (7 PubMed Identifiers)
  • The DNA sequence, annotation and analysis of human chromosome 3. [16641997]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Primary structure of tetranectin, a plasminogen kringle 4 binding plasma protein: homology with asialoglycoprotein receptors and cartilage proteoglycan core protein. [3427041]
  • Mass spectrometric characterisation of post-translational modification and genetic variation in human tetranectin. [10614823]
  • An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. [24275569]
  • Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil. [9256258]
  • Structure of the C-type lectin carbohydrate recognition domain of human tetranectin. [9757090]
All isoforms of this gene containing a lectin domain
NP_003269.2, NP_001295323.1, XP_016862605.1, XP_016862606.1
RNA
RNA (Transcript ID: NM_003278.3)
C-type lectin domain family 3 member B, transcript variant 1
m7G-5')ppp(5'-GUCACUGCGUUCGGACCCAGACCCGCUGCAGGCAGCAGCAGCCCCCGCCCGCGCAGCAGCAUGGAGCUCUGGGGGGCCUACCUCCUCCUCUGCCUCUUCUCCCUCCUGACCCAGGUCACCACCGAGCCACCAACCCAGAAGCCCAAGAAGAUUGUAAAUGCCAAGAAAGAUGUUGUGAACACAAAGAUGUUUGAGGAGCUCAAGAGCCGUCUGGACACCCUGGCCCAGGAGGUGGCCCUGCUGAAGGAGCAGCAGGCCCUGCAGACGGUCUGCCUGAAGGGGACCAAGGUGCACAUGAAAUGCUUUCUGGCCUUCACCCAGACGAAGACCUUCCACGAGGCCAGCGAGGACUGCAUCUCGCGCGGGGGCACCCUGGGCACCCCUCAGACUGGCUCGGAGAACGACGCCCUGUAUGAGUACCUGCGCCAGAGCGUGGGCAACGAGGCCGAGAUCUGGCUGGGCCUCAACGACAUGGCGGCCGAGGGCACCUGGGUGGACAUGACCGGCGCCCGCAUCGCCUACAAGAACUGGGAGACUGAGAUCACCGCGCAACCCGAUGGCGGCAAGACCGAGAACUGCGCGGUCCUGUCAGGCGCGGCCAACGGCAAGUGGUUCGACAAGCGCUGCCGCGAUCAGCUGCCCUACAUCUGCCAGUUCGGGAUCGUGUAGCCGGCGGGGCGGGGGCCGUGGGGGGCCUGGAGGAGGGCAGGGGCCGCGGGAGGCCGGGAGGAGGGUGGGGACCUUGCAGCCCCCAUCCUCUCCGUGCGCUUGGAGCCUCUUUUUGCAAAUAAAGUUGGUGCAGCUUCGCGGAGAGGA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 7123)
C-type lectin domain family 3 member B
strand +
TN
NCBI CDS gene sequence (609 bp)
5'-ATGGAGCTCTGGGGGGCCTACCTCCTCCTCTGCCTCTTCTCCCTCCTGACCCAGGTCACCACCGAGCCACCAACCCAGAAGCCCAAGAAGATTGTAAATGCCAAGAAAGATGTTGTGAACACAAAGATGTTTGAGGAGCTCAAGAGCCGTCTGGACACCCTGGCCCAGGAGGTGGCCCTGCTGAAGGAGCAGCAGGCCCTGCAGACGGTCTGCCTGAAGGGGACCAAGGTGCACATGAAATGCTTTCTGGCCTTCACCCAGACGAAGACCTTCCACGAGGCCAGCGAGGACTGCATCTCGCGCGGGGGCACCCTGGGCACCCCTCAGACTGGCTCGGAGAACGACGCCCTGTATGAGTACCTGCGCCAGAGCGTGGGCAACGAGGCCGAGATCTGGCTGGGCCTCAACGACATGGCGGCCGAGGGCACCTGGGTGGACATGACCGGCGCCCGCATCGCCTACAAGAACTGGGAGACTGAGATCACCGCGCAACCCGATGGCGGCAAGACCGAGAACTGCGCGGTCCTGTCAGGCGCGGCCAACGGCAAGTGGTTCGACAAGCGCTGCCGCGATCAGCTGCCCTACATCTGCCAGTTCGGGATCGTGTAG-3'
NCBI CDS gene sequence with introns (location: 45026363.. 45035924) (9562 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 45026303.. 45036071) (9769 bp)Download
NCBI gene sequence (location: [45026303 - 1000].. 45036071) (10769 bp)Download
Cite How to cite