Protein
Protein (NP_003269)
Tetranectin
Tetranectin (TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein)
CLEC3B
C-type lectin domain family 3 member B
Undefined
Curated
C-type lectin
CLEC3B
C-type - Tetranectin
a/b mixed / C-type lectin-like
MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Mol* PDB structure viewerUniLectin3D
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
- CLEC3B p.S106G Mutant in a Caucasian Population of Successful Neurological Aging. [31570938]
- CLEC3B protects H9c2 cardiomyocytes from apoptosis caused by hypoxia via the PI3K/Akt pathway. [32696821]
- Downregulation of exosomal CLEC3B in hepatocellular carcinoma promotes metastasis and angiogenesis via AMPK and VEGF signals. [31477130]
- The In Vitro Biotransformation of the Fusion Protein Tetranectin-Apolipoprotein A1. [30858459]
- CLEC3B is downregulated and inhibits proliferation in clear cell renal cell carcinoma. [30066941]
- The gene structure of tetranectin, a plasminogen binding protein. [1511740]
- Tetranectin, a plasminogen kringle 4-binding protein. Cloning and gene expression pattern in human colon cancer. [1354271]
- Identification of a highly mobilizable subset of human neutrophil intracellular vesicles that contains tetranectin and latent alkaline phosphatase. [2298916]
- Interaction of tetranectin with sulphated polysaccharides and trypan blue. [2533389]
- Purification and characterization of a novel, oligomeric, plasminogen kringle 4 binding protein from human plasma: tetranectin. [3009181]
UniProt Main References (7 PubMed Identifiers)
- The DNA sequence, annotation and analysis of human chromosome 3. [16641997]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Primary structure of tetranectin, a plasminogen kringle 4 binding plasma protein: homology with asialoglycoprotein receptors and cartilage proteoglycan core protein. [3427041]
- Mass spectrometric characterisation of post-translational modification and genetic variation in human tetranectin. [10614823]
- An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. [24275569]
- Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil. [9256258]
- Structure of the C-type lectin carbohydrate recognition domain of human tetranectin. [9757090]
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_003278.3)
C-type lectin domain family 3 member B, transcript variant 1
m7G-5')ppp(5'-GUCACUGCGUUCGGACCCAGACCCGCUGCAGGCAGCAGCAGCCCCCGCCCGCGCAGCAGCAUGGAGCUCUGGGGGGCCUACCUCCUCCUCUGCCUCUUCUCCCUCCUGACCCAGGUCACCACCGAGCCACCAACCCAGAAGCCCAAGAAGAUUGUAAAUGCCAAGAAAGAUGUUGUGAACACAAAGAUGUUUGAGGAGCUCAAGAGCCGUCUGGACACCCUGGCCCAGGAGGUGGCCCUGCUGAAGGAGCAGCAGGCCCUGCAGACGGUCUGCCUGAAGGGGACCAAGGUGCACAUGAAAUGCUUUCUGGCCUUCACCCAGACGAAGACCUUCCACGAGGCCAGCGAGGACUGCAUCUCGCGCGGGGGCACCCUGGGCACCCCUCAGACUGGCUCGGAGAACGACGCCCUGUAUGAGUACCUGCGCCAGAGCGUGGGCAACGAGGCCGAGAUCUGGCUGGGCCUCAACGACAUGGCGGCCGAGGGCACCUGGGUGGACAUGACCGGCGCCCGCAUCGCCUACAAGAACUGGGAGACUGAGAUCACCGCGCAACCCGAUGGCGGCAAGACCGAGAACUGCGCGGUCCUGUCAGGCGCGGCCAACGGCAAGUGGUUCGACAAGCGCUGCCGCGAUCAGCUGCCCUACAUCUGCCAGUUCGGGAUCGUGUAGCCGGCGGGGCGGGGGCCGUGGGGGGCCUGGAGGAGGGCAGGGGCCGCGGGAGGCCGGGAGGAGGGUGGGGACCUUGCAGCCCCCAUCCUCUCCGUGCGCUUGGAGCCUCUUUUUGCAAAUAAAGUUGGUGCAGCUUCGCGGAGAGGA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 7123)
C-type lectin domain family 3 member B
strand +
NCBI CDS gene sequence (609 bp)
5'-ATGGAGCTCTGGGGGGCCTACCTCCTCCTCTGCCTCTTCTCCCTCCTGACCCAGGTCACCACCGAGCCACCAACCCAGAAGCCCAAGAAGATTGTAAATGCCAAGAAAGATGTTGTGAACACAAAGATGTTTGAGGAGCTCAAGAGCCGTCTGGACACCCTGGCCCAGGAGGTGGCCCTGCTGAAGGAGCAGCAGGCCCTGCAGACGGTCTGCCTGAAGGGGACCAAGGTGCACATGAAATGCTTTCTGGCCTTCACCCAGACGAAGACCTTCCACGAGGCCAGCGAGGACTGCATCTCGCGCGGGGGCACCCTGGGCACCCCTCAGACTGGCTCGGAGAACGACGCCCTGTATGAGTACCTGCGCCAGAGCGTGGGCAACGAGGCCGAGATCTGGCTGGGCCTCAACGACATGGCGGCCGAGGGCACCTGGGTGGACATGACCGGCGCCCGCATCGCCTACAAGAACTGGGAGACTGAGATCACCGCGCAACCCGATGGCGGCAAGACCGAGAACTGCGCGGTCCTGTCAGGCGCGGCCAACGGCAAGTGGTTCGACAAGCGCTGCCGCGATCAGCTGCCCTACATCTGCCAGTTCGGGATCGTGTAG-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.