NCBI Summary
This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_002966)
Stem cell growth factor
C-type lectin domain family 11 member A (C-type lectin superfamily member 3) (Lymphocyte secreted C-type lectin) (Osteolectin) (Stem cell growth factor) (p47)
CLEC11A
C-type lectin domain containing 11A
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Tetranectin
a/b mixed / C-type lectin-like
Uncharacterised
0.347
Undefined
Protein sequence and protein families (fasta) (323 amino acids) Download
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.62, 2.12] ÅDownload
The location of the lectin domain structural model is: 153-322
We infer [1.62, 2.12] Å as the interval of error of this structural model.
Template 1: 6BBD chain: A, Q9N1X4, NP_999275.1, sequence identity: 23.5%, coverage: 87.6%, location in sequence: 225-378, (205-358 in PDB).
Template 2: 4WRE chain: A, P08427, NP_001257574.1, sequence identity: 22.9%, coverage: 82.9%, location in sequence: 108-248, (88-228 in PDB).
Template 3: 6JJJ chain: A, P70194, NP_058031.2, sequence identity: 18.8%, coverage: 81.2%, location in sequence: 393-543, (393-543 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
  • A reference map of the human binary protein interactome. [32296183]
  • Clec11a/osteolectin is an osteogenic growth factor that promotes the maintenance of the adult skeleton. [27976999]
  • Exploratory study for identifying systemic biomarkers that correlate with pain response in patients with intervertebral disc disorders. [26440592]
  • Elevated levels of endothelial-derived microparticles, and serum CXCL9 and SCGF-beta are associated with unstable asymptomatic carotid plaques. [26564003]
  • Cloning, mapping, and genomic organization of the LSLCL gene, encoding a new lymphocytic secreted mucin-like protein with a C-type lectin domain: A new model of exon shuffling. [10198175]
  • Isolation and characterization of a cDNA for human mouse, and rat full-length stem cell growth factor, a new member of C-type lectin superfamily. [9705843]
  • Molecular cloning of a new secreted sulfated mucin-like protein with a C-type lectin domain that is expressed in lymphoblastic cells. [9442024]
  • Cloning, expression, and characterization of a cDNA encoding a novel human growth factor for primitive hematopoietic progenitor cells. [9207134]
  • Production of human hematopoietic survival and growth factor by a myeloid leukemia cell line (KPB-M15) and placenta as detected by a monoclonal antibody. [3304620]
UniProt Main References (5 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Stem cell growth factor: in situ hybridization analysis on the gene expression, molecular characterization and in vitro proliferative activity of a recombinant preparation on primitive hematopoietic progenitor cells. [11920266]
  • Expression of LSLCL, a new C-type lectin, is closely restricted, in bone marrow, to immature neutrophils. [11803813]
  • N-terminome analysis of the human mitochondrial proteome. [25944712]
RNA
RNA (Transcript ID: NM_002975.3)
C-type lectin domain containing 11A
m7G-5')ppp(5'-AGAGACGAGGAGAGGAACAGGAAGAGAGAAGCUGGGAGAAUCGGGAACCUGGGGGCUAGUGACCUGCACACAGGGCAGGGGCACUCGGCAGUUCCCAGAGGCCACCCCUCCCACCCCAGACAUCCAGACAUCUGGAACUUUGGGUGCCAAGAGUCCAGCUUAAUGCAGGCAGCCUGGCUUUUGGGGGCUUUGGUGGUCCCCCAGCUCUUGGGCUUUGGCCAUGGGGCUCGGGGAGCAGAGAGGGAGUGGGAGGGAGGCUGGGGAGGUGCCCAGGAGGAGGAGCGGGAGAGGGAGGCCCUGAUGCUGAAGCAUCUGCAGGAAGCCCUAGGACUGCCUGCUGGGAGGGGGGAUGAGAAUCCUGCCGGAACUGUUGAGGGAAAAGAGGACUGGGAGAUGGAGGAGGACCAGGGGGAGGAAGAGGAGGAGGAAGCAACGCCAACCCCAUCCUCCGGCCCCAGCCCCUCUCCCACCCCUGAGGACAUCGUCACUUACAUCCUGGGCCGCCUGGCCGGCCUGGACGCAGGCCUGCACCAGCUGCACGUCCGUCUGCACGCGUUGGACACCCGCGUGGUCGAGCUGACCCAGGGGCUGCGGCAGCUGCGGAACGCGGCAGGCGACACCCGCGAUGCCGUGCAAGCCCUGCAGGAGGCGCAGGGUCGCGCCGAGCGCGAGCACGGCCGCUUGGAGGGCUGCCUGAAGGGGCUGCGCCUGGGCCACAAGUGCUUCCUGCUCUCGCGCGACUUCGAAGCUCAGGCGGCGGCGCAGGCGCGGUGCACGGCGCGGGGCGGGAGCCUGGCGCAGCCGGCAGACCGCCAGCAGAUGGAGGCGCUCACUCGGUACCUGCGCGCGGCGCUCGCUCCCUACAACUGGCCCGUGUGGCUGGGCGUGCACGAUCGGCGCGCCGAGGGCCUCUACCUCUUCGAAAACGGCCAGCGCGUGUCCUUCUUCGCCUGGCAUCGCUCACCCCGCCCCGAGCUCGGCGCCCAGCCCAGCGCCUCGCCGCAUCCGCUCAGCCCGGACCAGCCCAACGGUGGCACGCUCGAGAACUGCGUGGCGCAGGCCUCUGACGACGGCUCCUGGUGGGACCACGACUGCCAGCGGCGUCUCUACUACGUCUGCGAGUUCCCCUUCUAGCGGGGCCGGUACCCCGCCUCCCUGCCCAUCCCACCACCCGGCCUUUCCCUGCGCCGUGCCCACCCUCCUCCGGAAUCUCCCUUCCCUUCCUGGCCACGAAUGGCAGCGUCCUCCCCGACCCCCAGUCUGGGCGCUUCUGGGAGGGCUCUUGCGGUGCCGGCACUCCUCCUUGUUAGUGUCUUUCCUUGAAGGGGCGGGCACCAGGCUAGGUCCGGUGCCAAUAAAUCCUUGUGGAAUCUGA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 6320)
C-type lectin domain containing 11A
strand +
P47, LSLCL, CLECSF3
NCBI CDS gene sequence (972 bp)
5'-ATGCAGGCAGCCTGGCTTTTGGGGGCTTTGGTGGTCCCCCAGCTCTTGGGCTTTGGCCATGGGGCTCGGGGAGCAGAGAGGGAGTGGGAGGGAGGCTGGGGAGGTGCCCAGGAGGAGGAGCGGGAGAGGGAGGCCCTGATGCTGAAGCATCTGCAGGAAGCCCTAGGACTGCCTGCTGGGAGGGGGGATGAGAATCCTGCCGGAACTGTTGAGGGAAAAGAGGACTGGGAGATGGAGGAGGACCAGGGGGAGGAAGAGGAGGAGGAAGCAACGCCAACCCCATCCTCCGGCCCCAGCCCCTCTCCCACCCCTGAGGACATCGTCACTTACATCCTGGGCCGCCTGGCCGGCCTGGACGCAGGCCTGCACCAGCTGCACGTCCGTCTGCACGCGTTGGACACCCGCGTGGTCGAGCTGACCCAGGGGCTGCGGCAGCTGCGGAACGCGGCAGGCGACACCCGCGATGCCGTGCAAGCCCTGCAGGAGGCGCAGGGTCGCGCCGAGCGCGAGCACGGCCGCTTGGAGGGCTGCCTGAAGGGGCTGCGCCTGGGCCACAAGTGCTTCCTGCTCTCGCGCGACTTCGAAGCTCAGGCGGCGGCGCAGGCGCGGTGCACGGCGCGGGGCGGGAGCCTGGCGCAGCCGGCAGACCGCCAGCAGATGGAGGCGCTCACTCGGTACCTGCGCGCGGCGCTCGCTCCCTACAACTGGCCCGTGTGGCTGGGCGTGCACGATCGGCGCGCCGAGGGCCTCTACCTCTTCGAAAACGGCCAGCGCGTGTCCTTCTTCGCCTGGCATCGCTCACCCCGCCCCGAGCTCGGCGCCCAGCCCAGCGCCTCGCCGCATCCGCTCAGCCCGGACCAGCCCAACGGTGGCACGCTCGAGAACTGCGTGGCGCAGGCCTCTGACGACGGCTCCTGGTGGGACCACGACTGCCAGCGGCGTCTCTACTACGTCTGCGAGTTCCCCTTCTAG-3'
NCBI CDS gene sequence with introns (location: 50723526.. 50725467) (1942 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 50723364.. 50725708) (2345 bp)Download
NCBI gene sequence (location: [50723364 - 1000].. 50725708) (3345 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905