NCBI Summary
This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009].
Protein
Protein (NP_000646)
L-selectin
L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte surface antigen Leu-8) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90-MEL) (CD antigen CD62L)
SELL
selectin L
Curated
C-type lectin
SELL
C-type - Selectins
a/b mixed / C-type lectin-like
0.452
Protein sequence and protein families (fasta) (372 amino acids) Download
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
Mana13(Mana16)Manb14GlcNAcb14GlcNAc
Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
References
NCBI References (10 PubMed Identifiers)
  • Circulating ILC precursors expressing CD62L exhibit a type 2 signature distinctly decreased in psoriatic patients. [33728641]
  • An increase in CD62Ldim neutrophils precedes the development of pulmonary embolisms in COVID-19 patients. [33482019]
  • L-selectin regulates human neutrophil transendothelial migration. [33408247]
  • Tumors exploit CXCR4hiCD62Llo aged neutrophils to facilitate metastatic spread. [33537175]
  • L-Selectin P213S and Integrin Alpha 2 C807T Genetic Polymorphisms in Pediatric Sickle Cell Disease Patients. [32433445]
  • An endothelial ligand for L-selectin is a novel mucin-like molecule. [1376638]
  • Cell-cell contact mechanisms. [1375831]
  • Selectins: a family of adhesion receptors. [1717161]
  • Structure of the gene encoding the human leukocyte adhesion molecule-1 (TQ1, Leu-8) of lymphocytes and neutrophils. [1692315]
  • Isolation and chromosomal localization of cDNAs encoding a novel human lymphocyte cell surface molecule, LAM-1. Homology with the mouse lymphocyte homing receptor and other human adhesion proteins. [2473156]
UniProt Main References (13 PubMed Identifiers)
  • Human homologue of mouse lymph node homing receptor: evolutionary conservation at tandem cell interaction domains. [2664786]
  • Leu-8/TQ1 is the human equivalent of the Mel-14 lymph node homing receptor. [2509939]
  • Characterization of a human homologue of the murine peripheral lymph node homing receptor. [2663882]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. [16335952]
  • Molecular basis of leukocyte rolling on PSGL-1. Predominant role of core-2 O-glycans and of tyrosine sulfate residue 51. [12403782]
  • Model glycosulfopeptides from P-selectin glycoprotein ligand-1 require tyrosine sulfation and a core 2-branched O-glycan to bind to L-selectin. [12736247]
  • Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins. [18606703]
  • Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. [19349973]
  • Show more
RNA
RNA (Transcript ID: NM_000655.5)
selectin L, transcript variant 1
m7G-5')ppp(5'-GACAUUCAGUGCAGUCUACCUGCAGCACAGCACACUCCCUUUGGGCAAGGACCUGAGACCCUUGUGCUAAGUCAAGAGGCUCAAUGGGCUGCAGAAGAACUAGAGAAGGACCAAGCAAAGCCAUGAUAUUUCCAUGGAAAUGUCAGAGCACCCAGAGGGACUUAUGGAACAUCUUCAAGUUGUGGGGGUGGACAAUGCUCUGUUGUGAUUUCCUGGCACAUCAUGGAACCGACUGCUGGACUUACCAUUAUUCUGAAAAACCCAUGAACUGGCAAAGGGCUAGAAGAUUCUGCCGAGACAAUUACACAGAUUUAGUUGCCAUACAAAACAAGGCGGAAAUUGAGUAUCUGGAGAAGACUCUGCCUUUCAGUCGUUCUUACUACUGGAUAGGAAUCCGGAAGAUAGGAGGAAUAUGGACGUGGGUGGGAACCAACAAAUCUCUUACUGAAGAAGCAGAGAACUGGGGAGAUGGUGAGCCCAACAACAAGAAGAACAAGGAGGACUGCGUGGAGAUCUAUAUCAAGAGAAACAAAGAUGCAGGCAAAUGGAACGAUGACGCCUGCCACAAACUAAAGGCAGCCCUCUGUUACACAGCUUCUUGCCAGCCCUGGUCAUGCAGUGGCCAUGGAGAAUGUGUAGAAAUCAUCAAUAAUUACACCUGCAACUGUGAUGUGGGGUACUAUGGGCCCCAGUGUCAGUUUGUGAUUCAGUGUGAGCCUUUGGAGGCCCCAGAGCUGGGUACCAUGGACUGUACUCACCCUUUGGGAAACUUCAGCUUCAGCUCACAGUGUGCCUUCAGCUGCUCUGAAGGAACAAACUUAACUGGGAUUGAAGAAACCACCUGUGGACCAUUUGGAAACUGGUCAUCUCCAGAACCAACCUGUCAAGUGAUUCAGUGUGAGCCUCUAUCAGCACCAGAUUUGGGGAUCAUGAACUGUAGCCAUCCCCUGGCCAGCUUCAGCUUUACCUCUGCAUGUACCUUCAUCUGCUCAGAAGGAACUGAGUUAAUUGGGAAGAAGAAAACCAUUUGUGAAUCAUCUGGAAUCUGGUCAAAUCCUAGUCCAAUAUGUCAAAAAUUGGACAAAAGUUUCUCAAUGAUUAAGGAGGGUGAUUAUAACCCCCUCUUCAUUCCAGUGGCAGUCAUGGUUACUGCAUUCUCUGGGUUGGCAUUUAUCAUUUGGCUGGCAAGGAGAUUAAAAAAAGGCAAGAAAUCCAAGAGAAGUAUGAAUGACCCAUAUUAAAUCGCCCUUGGUGAAAGAAAAUUCUUGGAAUACUAAAAAUCAUGAGAUCCUUUAAAUCCUUCCAUGAAACGUUUUGUGUGGUGGCACCUCCUACGUCAAACAUGAAGUGUGUUUCCUUCAGUGCAUCUGGGAAGAUUUCUACCUGACCAACAGUUCCUUCAGCUUCCAUUUCGCCCCUCAUUUAUCCCUCAACCCCCAGCCCACAGGUGUUUAUACAGCUCAGCUUUUUGUCUUUUCUGAGGAGAAACAAAUAAGACCAUAAAGGGAAAGGAUUCAUGUGGAAUAUAAAGAUGGCUGACUUUGCUCUUUCUUGACUCUUGUUUUCAGUUUCAAUUCAGUGCUGUACUUGAUGACAGACACUUCUAAAUGAAGUGCAAAUUUGAUACAUAUGUGAAUAUGGACUCAGUUUUCUUGCAGAUCAAAUUUCACGUCGUCUUCUGUAUACUGUGGAGGUACACUCUUAUAGAAAGUUCAAAAAGUCUACGCUCUCCUUUCUUUCUAACUCCAGUGAAGUAAUGGGGUCCUGCUCAAGUUGAAAGAGUCCUAUUUGCACUGUAGCCUCGCCGUCUGUGAAUUGGACCAUCCUAUUUAACUGGCUUCAGCCUCCCCACCUUCUUCAGCCACCUCUCUUUUUCAGUUGGCUGACUUCCACACCUAGCAUCUCAUGAGUGCCAAGCAAAAGGAGAGAAGAGAGAAAUAGCCUGCGCUGUUUUUUAGUUUGGGGGUUUUGCUGUUUCCUUUUAUGAGACCCAUUCCUAUUUCUUAUAGUCAAUGUUUCUUUUAUCACGAUAUUAUUAGUAAGAAAACAUCACUGAAAUGCUAGCUGCAAGUGACAUCUCUUUGAUGUCAUAUGGAAGAGUUAAAACAGGUGGAGAAAUUCCUUGAUUCACAAUGAAAUGCUCUCCUUUCCCCUGCCCCCAGACCUUUUAUCCACUUACCUAGAUUCUACAUAUUCUUUAAAUUUCAUCUCAGGCCUCCCUCAACCCCACCACUUCUUUUAUAACUAGUCCUUUACUAAUCCAACCCAUGAUGAGCUCCUCUUCCUGGCUUCUUACUGAAAGGUUACCCUGUAACAUGCAAUUUUGCAUUUGAAUAAAGCCUGCUUUUUAAGUGUUAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 6402)
selectin L
strand -
LSEL, LAM1, LAM-1, hLHRc, Leu-8, Lyam-1, PLNHR, CD62L
NCBI CDS gene sequence (1119 bp)
5'-ATGATATTTCCATGGAAATGTCAGAGCACCCAGAGGGACTTATGGAACATCTTCAAGTTGTGGGGGTGGACAATGCTCTGTTGTGATTTCCTGGCACATCATGGAACCGACTGCTGGACTTACCATTATTCTGAAAAACCCATGAACTGGCAAAGGGCTAGAAGATTCTGCCGAGACAATTACACAGATTTAGTTGCCATACAAAACAAGGCGGAAATTGAGTATCTGGAGAAGACTCTGCCTTTCAGTCGTTCTTACTACTGGATAGGAATCCGGAAGATAGGAGGAATATGGACGTGGGTGGGAACCAACAAATCTCTTACTGAAGAAGCAGAGAACTGGGGAGATGGTGAGCCCAACAACAAGAAGAACAAGGAGGACTGCGTGGAGATCTATATCAAGAGAAACAAAGATGCAGGCAAATGGAACGATGACGCCTGCCACAAACTAAAGGCAGCCCTCTGTTACACAGCTTCTTGCCAGCCCTGGTCATGCAGTGGCCATGGAGAATGTGTAGAAATCATCAATAATTACACCTGCAACTGTGATGTGGGGTACTATGGGCCCCAGTGTCAGTTTGTGATTCAGTGTGAGCCTTTGGAGGCCCCAGAGCTGGGTACCATGGACTGTACTCACCCTTTGGGAAACTTCAGCTTCAGCTCACAGTGTGCCTTCAGCTGCTCTGAAGGAACAAACTTAACTGGGATTGAAGAAACCACCTGTGGACCATTTGGAAACTGGTCATCTCCAGAACCAACCTGTCAAGTGATTCAGTGTGAGCCTCTATCAGCACCAGATTTGGGGATCATGAACTGTAGCCATCCCCTGGCCAGCTTCAGCTTTACCTCTGCATGTACCTTCATCTGCTCAGAAGGAACTGAGTTAATTGGGAAGAAGAAAACCATTTGTGAATCATCTGGAATCTGGTCAAATCCTAGTCCAATATGTCAAAAATTGGACAAAAGTTTCTCAATGATTAAGGAGGGTGATTATAACCCCCTCTTCATTCCAGTGGCAGTCATGGTTACTGCATTCTCTGGGTTGGCATTTATCATTTGGCTGGCAAGGAGATTAAAAAAAGGCAAGAAATCCAAGAGAAGTATGAATGACCCATATTAA-3'
NCBI CDS gene sequence with introns (location: 169691784.. 169711498) (19715 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 169690667.. 169711620) (20954 bp)Download
NCBI gene sequence (location: [169690667.. 169711620 + 1000]) (21954 bp)Download
Cite How to cite