NCBI Summary
The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. The encoded protein contains a peptide that displays potent antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria, and fungi. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014].
Protein
Protein (NP_002719)
Bone marrow proteoglycan 2
Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)]
PRG2
proteoglycan 2, pro eosinophil major basic protein
Undefined
Curated
C-type lectin
Undefined
C-type - CTLD/acidic neck
a/b mixed / C-type lectin-like
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Mol* PDB structure viewerUniLectin3D
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
- Development and application of novel immunoassays for eosinophil granule major basic proteins to evaluate eosinophilia and myeloproliferative disorders. [33689807]
- Mechanism of atopic cataract caused by eosinophil granule major basic protein. [31595373]
- Re-Expression of Bone Marrow Proteoglycan-2 by 5-Azacytidine is associated with STAT3 Inactivation and SensitivityResponse to Imatinib in Resistant CML Cells [29936783]
- Proteomic characterization of human multiple myeloma bone marrow extracellular matrix. [28344315]
- Toxicity of eosinophil MBP is repressed by intracellular crystallization and promoted by extracellular aggregation. [25728769]
- Purification and cDNA cloning of a novel factor produced by a human T-cell hybridoma: sequence homology with animal lectins. [1565101]
- Cloning and sequence analysis of the human gene encoding eosinophil major basic protein. [2323577]
- Antibiotic proteins of human polymorphonuclear leukocytes. [2501794]
- Isolation of a complementary DNA clone encoding a precursor to human eosinophil major basic protein. [3199069]
- Localization of somatostatin-like immunoreactivity in the pancreatic islets of the hagfish, Myxine glutinosa and the lamprey Lampetra fluviatilis. [319906]
UniProt Main References (21 PubMed Identifiers)
- Acidic precursor revealed in human eosinophil granule major basic protein cDNA. [3171483]
- Human eosinophil major basic protein, a mediator of allergic inflammation, is expressed by alternative splicing from two promoters. [7531438]
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- Human chromosome 11 DNA sequence and analysis including novel gene identification. [16554811]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Pro-major basic protein has three types of sugar chains at the pro-portion. [8507662]
- Circulating human pregnancy-associated plasma protein-A is disulfide-bridged to the proform of eosinophil major basic protein. [7685339]
- Identification of angiotensinogen and complement C3dg as novel proteins binding the proform of eosinophil major basic protein in human pregnancy serum and plasma. [7539791]
- Biochemical and amino acid sequence analysis of human eosinophil granule major basic protein. [3410852]
- Eosinophil granule cationic proteins: major basic protein is distinct from the smaller subunit of eosinophil peroxidase. [3422083] Show more
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_002728.6)
proteoglycan 2, pro eosinophil major basic protein, transcript variant 1
m7G-5')ppp(5'-AAAGAAGGACCUGGGCUUUGGGAAGAUCUAAAGACCCAGGAAGGUCUCUGGGUGGGAUAAAGCCAAGAUGAAACUCCCCUUACUUCUGGCUCUUCUAUUUGGGGCAGUUUCUGCUCUUCAUCUAAGGUCUGAGACUUCCACCUUUGAGACCCCUUUGGGUGCUAAGACGCUGCCUGAGGAUGAGGAGACACCAGAGCAGGAGAUGGAGGAGACCCCUUGCAGGGAGCUGGAGGAAGAGGAGGAGUGGGGCUCUGGAAGUGAAGAUGCCUCCAAGAAAGAUGGGGCUGUUGAGUCUAUCUCAGUGCCAGAUAUGGUGGACAAAAACCUUACGUGUCCUGAGGAAGAGGACACAGUAAAAGUGGUGGGCAUCCCUGGGUGCCAGACCUGCCGCUACCUCCUGGUGAGAAGUCUUCAGACGUUUAGUCAAGCUUGGUUUACUUGCCGGAGGUGCUACAGGGGCAACCUGGUUUCCAUCCACAACUUCAAUAUUAAUUAUCGAAUCCAGUGUUCUGUCAGCGCGCUCAACCAGGGUCAAGUCUGGAUUGGAGGCAGGAUCACAGGCUCGGGUCGCUGCAGACGCUUUCAGUGGGUUGACGGCAGCCGCUGGAACUUUGCAUACUGGGCUGCUCACCAGCCCUGGUCCCGCGGUGGUCACUGCGUGGCCCUGUGUACCCGAGGAGGCCACUGGCGUCGAGCCCACUGCCUCAGAAGACUUCCUUUCAUCUGUUCCUACUGAGCUGGUCCCAGCCAGCAGUUCAGAGCUGCCCUCUCCUGGGCAGCUGCCUCCCCUCCUCUGCUUGCCAUCCCUCCCUCCACCUCCCUGCAAUAAAAUGGGUUUUACUGAAAUGGAUUUAUUUUCUCCUCUGAUCGCGGAUCCACUCUGCUUAGCCCUCAUUGAAACUUCUUCCUUAUCAUCUCUCCCCACACCACAACUUUCAUAGAAGUGUCAGAAGCUACUACUCCUUGAGGAGGAGGAUGGAGGGUGGAGUUGGGUCUAUGGAGCCUUUUGGAGAUGGAGGAAUGGGCUCAGCUAGUUCUCUUCAUAGAACACCUGAUUACUGGGCACCUGCAUAGUGCUGCCAGGACCUUUCAAGGUUGUAGGUAGACUCCCAAUGGCCCAGUUUGCAUCUCUGUAACCAAAGGCCUUUUCUCUCUCUCUCUCCAACCCCAGAACUGUGGUUGGUUUUAUAUGUAAGGAAGUUAACAUGUCCCUGGGAACAGUCCACAACAUUCAGGAAUGAAUGUAUAAGUACCGCAAUCCCCGGCCCCUCAAGUGGAAUAAAUCUAACAUGUAUUGGGCACCAUUUCCCAGUGGCCUGCUGUGGUAGUUGGCCUUAUUCCAUGCAUUUUUAUGGGCUGCCUUCCCUUCCUCAACUGCAUUCUCUGCUCCUUCCUACUCUCUGCAACUCCCAAAUAAACACUUGUACGCAA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 5553)
proteoglycan 2, pro eosinophil major basic protein
strand -
MBP, BMPG, proMBP
NCBI CDS gene sequence (669 bp)
5'-ATGAAACTCCCCTTACTTCTGGCTCTTCTATTTGGGGCAGTTTCTGCTCTTCATCTAAGGTCTGAGACTTCCACCTTTGAGACCCCTTTGGGTGCTAAGACGCTGCCTGAGGATGAGGAGACACCAGAGCAGGAGATGGAGGAGACCCCTTGCAGGGAGCTGGAGGAAGAGGAGGAGTGGGGCTCTGGAAGTGAAGATGCCTCCAAGAAAGATGGGGCTGTTGAGTCTATCTCAGTGCCAGATATGGTGGACAAAAACCTTACGTGTCCTGAGGAAGAGGACACAGTAAAAGTGGTGGGCATCCCTGGGTGCCAGACCTGCCGCTACCTCCTGGTGAGAAGTCTTCAGACGTTTAGTCAAGCTTGGTTTACTTGCCGGAGGTGCTACAGGGGCAACCTGGTTTCCATCCACAACTTCAATATTAATTATCGAATCCAGTGTTCTGTCAGCGCGCTCAACCAGGGTCAAGTCTGGATTGGAGGCAGGATCACAGGCTCGGGTCGCTGCAGACGCTTTCAGTGGGTTGACGGCAGCCGCTGGAACTTTGCATACTGGGCTGCTCACCAGCCCTGGTCCCGCGGTGGTCACTGCGTGGCCCTGTGTACCCGAGGAGGCCACTGGCGTCGAGCCCACTGCCTCAGAAGACTTCCTTTCATCTGTTCCTACTGA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.