NCBI Summary
This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014].
Protein
Protein (NP_002571)
HIP - PAP Regenerating family member 3 alpha
Regenerating islet-derived protein 3-alpha (REG-3-alpha) (Hepatointestinal pancreatic protein) (HIP/PAP) (Human proislet peptide) (Pancreatitis-associated protein 1) (Regenerating islet-derived protein III-alpha) (Reg III-alpha) [Cleaved into: Regenerating islet-derived protein 3-alpha 16.5 kDa form; Regenerating islet-derived protein 3-alpha 15 kDa form]
REG3A
regenerating family member 3 alpha
Undefined
Curated
C-type lectin
REG3A
C-type - Free C-type Lectin Domains CTLDs
a/b mixed / C-type lectin-like
Chitin / peptidoglycan
0.345
Protein sequence and protein families (fasta) (175 amino acids) Download
MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Forms a hexameric membrane-permeabilizing oligomeric pore on membrane phospholipids. The hexamer is formed by three dimers related by helical symmetry (PubMed:24256734). Forms filaments, filamentation traps pore complexes and limits damage to host cells (PubMed:24256734). Interacts with EXTL3
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • Secretome screening reveals immunomodulating functions of IFNalpha-7, PAP and GDF-7 on regulatory T-cells. [34408239]
  • REG3A/REG3B promotes acinar to ductal metaplasia through binding to EXTL3 and activating the RAS-RAF-MEK-ERK signaling pathway. [34099862]
  • Myocardial Accumulations of Reg3A, Reg3gamma and Oncostatin M Are Associated with the Formation of Granulomata in Patients with Cardiac Sarcoidosis. [33923774]
  • Symbiotic bacteria direct expression of an intestinal bactericidal lectin. [16931762]
  • The human pancreatitis-associated protein (PAP)-encoding gene generates multiple transcripts through alternative use of 5' exons. [7721106]
  • Structural organization and chromosomal localization of a human gene (HIP/PAP) encoding a C-type lectin overexpressed in primary liver cancer. [8076648]
  • Molecular cloning, genomic organization, and chromosomal localization of the human pancreatitis-associated protein (PAP) gene. [8188210]
  • Cloning and tissue-specific expression of cDNAs for the human and mouse homologues of rat pancreatitis-associated protein (PAP). [7679928]
  • Human pancreatitis-associated protein. Messenger RNA cloning and expression in pancreatic diseases. [1469087]
  • A novel gene (HIP) activated in human primary liver cancer. [1325291]
UniProt Main References (4 PubMed Identifiers)
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Proteolytic activation of human pancreatitis-associated protein is required for peptidoglycan binding and bacterial aggregation. [19254208]
  • The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury. [22727489]
  • Molecular basis for peptidoglycan recognition by a bactericidal lectin. [20382864]
All isoforms of this gene containing a lectin domain
NP_002571.1, NP_620354.1, NP_620355.1
RNA
RNA (Transcript ID: NM_002580.3)
regenerating family member 3 alpha, transcript variant 1
m7G-5')ppp(5'-AAACCAUACCAUAUCCCACCAGAGAGUGACUCCUGAUUGCCUCCUCAAGUCGCAGACACUAUGCUGCCUCCCAUGGCCCUGCCCAGUGUAUCUUGGAUGCUGCUUUCCUGCCUCAUGCUGCUGUCUCAGGUUCAAGGUGAAGAACCCCAGAGGGAACUGCCCUCUGCACGGAUCCGCUGUCCCAAAGGCUCCAAGGCCUAUGGCUCCCACUGCUAUGCCUUGUUUUUGUCACCAAAAUCCUGGACAGAUGCAGAUCUGGCCUGCCAGAAGCGGCCCUCUGGAAACCUGGUGUCUGUGCUCAGUGGGGCUGAGGGAUCCUUCGUGUCCUCCCUGGUGAAGAGCAUUGGUAACAGCUACUCAUACGUCUGGAUUGGGCUCCAUGACCCCACACAGGGCACCGAGCCCAAUGGAGAAGGUUGGGAGUGGAGUAGCAGUGAUGUGAUGAAUUACUUUGCAUGGGAGAGAAAUCCCUCCACCAUCUCAAGCCCCGGCCACUGUGCGAGCCUGUCGAGAAGCACAGCAUUUCUGAGGUGGAAAGAUUAUAACUGUAAUGUGAGGUUACCCUAUGUCUGCAAGUUCACUGACUAGUGCAGGAGGGAAGUCAGCAGCCUGUGUUUGGUGUGCAACUCAUCAUGGGCAUGAGACCAGUGUGAGGACUCACCCUGGAAGAGAAUAUUCGCUUAAUUCCCCCAACCUGACCACCUCAUUCUUAUCUUUCUUCUGUUUCUUCCUCCCCGCUGUCAUUUCAGUCUCUUCAUUUUGUCAUACGGCCUAAGGCUUUAAAGAGCAAUAAAAUUUUUAGUCUGCA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 5068)
regenerating family member 3 alpha
strand -
HIP, REG-III, REG3, PBCGF, PAP1
NCBI CDS gene sequence (528 bp)
5'-ATGCTGCCTCCCATGGCCCTGCCCAGTGTATCTTGGATGCTGCTTTCCTGCCTCATGCTGCTGTCTCAGGTTCAAGGTGAAGAACCCCAGAGGGAACTGCCCTCTGCACGGATCCGCTGTCCCAAAGGCTCCAAGGCCTATGGCTCCCACTGCTATGCCTTGTTTTTGTCACCAAAATCCTGGACAGATGCAGATCTGGCCTGCCAGAAGCGGCCCTCTGGAAACCTGGTGTCTGTGCTCAGTGGGGCTGAGGGATCCTTCGTGTCCTCCCTGGTGAAGAGCATTGGTAACAGCTACTCATACGTCTGGATTGGGCTCCATGACCCCACACAGGGCACCGAGCCCAATGGAGAAGGTTGGGAGTGGAGTAGCAGTGATGTGATGAATTACTTTGCATGGGAGAGAAATCCCTCCACCATCTCAAGCCCCGGCCACTGTGCGAGCCTGTCGAGAAGCACAGCATTTCTGAGGTGGAAAGATTATAACTGTAATGTGAGGTTACCCTATGTCTGCAAGTTCACTGACTAG-3'
NCBI CDS gene sequence with introns (location: 79157226.. 79159405) (2180 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 79157006.. 79159753) (2748 bp)Download
NCBI gene sequence (location: [79157006.. 79159753 + 1000]) (3748 bp)Download
Cite How to cite