NCBI Summary
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014].
Protein
Protein (NP_002297)
Galectin 3
Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)
LGALS3
galectin 3
Undefined
Curated
galectin-like
S-Type Lectins - Chimeric
b-sandwich / ConA-like
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Mol* PDB structure viewerUniLectin3D
Ligand
Glycan ligands from structural data
fluoroaryltriazole monothiogalactoside , aGalA14GalAa14GalA, 3-deoxy-3-(4-[m-fluorophenyl]-1H-1, thiodigalactoside, fluoroaryltriazole monothiogalactoside, LacNAc derivative, fluoroaryl triazole monothiogalactoside, bGal14Glc, substituted fluoroaryltriazole monothiogalactoside, LacNAc derivativee, Thio di-galactoside derivative, substituted polyfluoroaryl monothiogalactoside, galactose derivative, thiodigalactoside derivative, fluoroaryltriazole monothiogalactoside
Gal
References
NCBI References (10 PubMed Identifiers)
- Predictors of Total Mortality and Serious Arrhythmic Events in Non-Ischemic Heart Failure Patients: The Role of Galectin-3. [34550239]
- Relationship between Circulating Galectin-3, Systemic Inflammation, and Protein-Energy Wasting in Chronic Hemodialysis Patients. [34444962]
- The Role of Galectin-3 and ST2 in Cardiology: A Short Review. [34439833]
- Galectin-3 induces death of Candida species expressing specific beta-1,2-linked mannans. [16982911]
- Mapping of the galectin-3 gene (LGALS3) to human chromosome 14 at region 14q21-22. [9271684]
- Mac-2-binding glycoproteins. Putative ligands for a cytosolic beta-galactoside lectin. [1917996]
- Molecular cloning and chromosomal mapping of a human galactoside-binding protein. [2009535]
- Human breast carcinoma cDNA encoding a galactoside-binding lectin homologous to mouse Mac-2 antigen. [2022338]
- Genomic sequence and organization of two members of a human lectin gene family. [1988031]
- Molecular cloning of a human macrophage lectin specific for galactose. [2402511]
UniProt Main References (19 PubMed Identifiers)
- Human IgE-binding protein: a soluble lectin exhibiting a highly conserved interspecies sequence and differential recognition of IgE glycoforms. [2261464]
- Decreased expression of Mac-2 (carbohydrate binding protein 35) and loss of its nuclear localization are associated with the neoplastic progression of colon carcinoma. [7682704]
- The human LGALS3 (galectin-3) gene: determination of the gene structure and functional characterization of the promoter. [9439577]
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- The DNA sequence and analysis of human chromosome 14. [12508121]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6 and serine 12 in vivo and by casein kinase I. [8253806]
- Mac-2 binding protein is a cell-adhesive protein of the extracellular matrix which self-assembles into ring-like structures and binds beta1 integrins, collagens and fibronectin. [9501082]
- NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin. [15181153]
- The regulation of inflammation by galectin-3. [19594635] Show more
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_002306.4)
m7G-5')ppp(5'-GCCCGCAGCACCUCCUCGCCAGCAGCCGUCCGGAGCCAGCCAACGAGCGGAAAAUGGCAGACAAUUUUUCGCUCCAUGAUGCGUUAUCUGGGUCUGGAAACCCAAACCCUCAAGGAUGGCCUGGCGCAUGGGGGAACCAGCCUGCUGGGGCAGGGGGCUACCCAGGGGCUUCCUAUCCUGGGGCCUACCCCGGGCAGGCACCCCCAGGGGCUUAUCCUGGACAGGCACCUCCAGGCGCCUACCCUGGAGCACCUGGAGCUUAUCCCGGAGCACCUGCACCUGGAGUCUACCCAGGGCCACCCAGCGGCCCUGGGGCCUACCCAUCUUCUGGACAGCCAAGUGCCACCGGAGCCUACCCUGCCACUGGCCCCUAUGGCGCCCCUGCUGGGCCACUGAUUGUGCCUUAUAACCUGCCUUUGCCUGGGGGAGUGGUGCCUCGCAUGCUGAUAACAAUUCUGGGCACGGUGAAGCCCAAUGCAAACAGAAUUGCUUUAGAUUUCCAAAGAGGGAAUGAUGUUGCCUUCCACUUUAACCCACGCUUCAAUGAGAACAACAGGAGAGUCAUUGUUUGCAAUACAAAGCUGGAUAAUAACUGGGGAAGGGAAGAAAGACAGUCGGUUUUCCCAUUUGAAAGUGGGAAACCAUUCAAAAUACAAGUACUGGUUGAACCUGACCACUUCAAGGUUGCAGUGAAUGAUGCUCACUUGUUGCAGUACAAUCAUCGGGUUAAAAAACUCAAUGAAAUCAGCAAACUGGGAAUUUCUGGUGACAUAGACCUCACCAGUGCUUCAUAUACCAUGAUAUAAUCUGAAAGGGGCAGAUUAAAAAAAAAAAAAGAAUCUAAACCUUACAUGUGUAAAGGUUUCAUGUUCACUGUGAGUGAAAAUUUUUACAUUCAUCAAUAUCCCUCUUGUAAGUCAUCUACUUAAUAAAUAUUACAGUGAAUUACCUGUCUCAA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 3958)
galectin 3
strand +
MAC-2, GALIG
NCBI CDS gene sequence (753 bp)
5'-ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTGGCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGGGCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCCTGGAGCACCTGGAGCTTATCCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGACAGCCAAGTGCCACCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATATAA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.