NCBI Summary
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014].
Protein
Protein (NP_002297)
Galectin 3
Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)
LGALS3
galectin 3
Undefined
Curated
Galectin
S-Type Lectins - Chimeric
b-sandwich / ConA-like
0.505
Protein sequence and protein families (fasta) (250 amino acids) Download
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
galactose derivative (S-enantiomer)
GalA(a1-4)GalA
Thio di-galactoside derivative, bGal14Glc, aGalA14GalA
Gal(b1-4)Glc
bGal14GlcNAc13bGal14Glc
Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
Gal derivative
GalNAc(b1-4)GlcNAc
bGal13aGalNAc-Ser, bGal13aGalNAc-PNP
Gal(b1-3)GalNAc
bGal13GlcNAc13bGal14Glc
Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)Glc
bGal14Glc
Gal(b1-4)Fruf
fluoroaryltriazole monothiogalactoside , aGalA14GalAa14GalA, 3-deoxy-3-(4-[m-fluorophenyl]-1H-1, thiodigalactoside, fluoroaryltriazole monothiogalactoside, LacNAc derivative, fluoroaryl triazole monothiogalactoside, bGal14Glc, substituted fluoroaryltriazole monothiogalactoside, LacNAc derivativee, Thio di-galactoside derivative, substituted polyfluoroaryl monothiogalactoside, galactose derivative, thiodigalactoside derivative, fluoroaryltriazole monothiogalactoside
Gal
derivative of LacNAc, LacNAc derivative, 3-triazol-1-yl)-thio-digalactoside, GLYCEROL, benzamido-N-acetyllactosamine, bGal14GlcNAc
Gal(b1-4)GlcNAc
bGal13GlcNAc
Gal(b1-3)GlcNAc
aNeuAc23bGal14Glc
NeuAc(a2-3)Gal(b1-4)Glc
thioditaloside, MQT, DQT
Tal
Lactitol
Gal(b1-4)Gal
galactose derivative (R enantiomer)
GalA(a1-4)GalA(a1-4)GalA
References
NCBI References (10 PubMed Identifiers)
  • Predictors of Total Mortality and Serious Arrhythmic Events in Non-Ischemic Heart Failure Patients: The Role of Galectin-3. [34550239]
  • Relationship between Circulating Galectin-3, Systemic Inflammation, and Protein-Energy Wasting in Chronic Hemodialysis Patients. [34444962]
  • The Role of Galectin-3 and ST2 in Cardiology: A Short Review. [34439833]
  • Galectin-3 induces death of Candida species expressing specific beta-1,2-linked mannans. [16982911]
  • Mapping of the galectin-3 gene (LGALS3) to human chromosome 14 at region 14q21-22. [9271684]
  • Mac-2-binding glycoproteins. Putative ligands for a cytosolic beta-galactoside lectin. [1917996]
  • Molecular cloning and chromosomal mapping of a human galactoside-binding protein. [2009535]
  • Human breast carcinoma cDNA encoding a galactoside-binding lectin homologous to mouse Mac-2 antigen. [2022338]
  • Genomic sequence and organization of two members of a human lectin gene family. [1988031]
  • Molecular cloning of a human macrophage lectin specific for galactose. [2402511]
UniProt Main References (19 PubMed Identifiers)
  • Human IgE-binding protein: a soluble lectin exhibiting a highly conserved interspecies sequence and differential recognition of IgE glycoforms. [2261464]
  • Decreased expression of Mac-2 (carbohydrate binding protein 35) and loss of its nuclear localization are associated with the neoplastic progression of colon carcinoma. [7682704]
  • The human LGALS3 (galectin-3) gene: determination of the gene structure and functional characterization of the promoter. [9439577]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and analysis of human chromosome 14. [12508121]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6 and serine 12 in vivo and by casein kinase I. [8253806]
  • Mac-2 binding protein is a cell-adhesive protein of the extracellular matrix which self-assembles into ring-like structures and binds beta1 integrins, collagens and fibronectin. [9501082]
  • NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin. [15181153]
  • The regulation of inflammation by galectin-3. [19594635]
  • Show more
All isoforms of this gene containing a lectin domain
NP_002297.2, NP_001344607.1
RNA
RNA (Transcript ID: NM_002306.4)
galectin 3, transcript variant 1
m7G-5')ppp(5'-GCCCGCAGCACCUCCUCGCCAGCAGCCGUCCGGAGCCAGCCAACGAGCGGAAAAUGGCAGACAAUUUUUCGCUCCAUGAUGCGUUAUCUGGGUCUGGAAACCCAAACCCUCAAGGAUGGCCUGGCGCAUGGGGGAACCAGCCUGCUGGGGCAGGGGGCUACCCAGGGGCUUCCUAUCCUGGGGCCUACCCCGGGCAGGCACCCCCAGGGGCUUAUCCUGGACAGGCACCUCCAGGCGCCUACCCUGGAGCACCUGGAGCUUAUCCCGGAGCACCUGCACCUGGAGUCUACCCAGGGCCACCCAGCGGCCCUGGGGCCUACCCAUCUUCUGGACAGCCAAGUGCCACCGGAGCCUACCCUGCCACUGGCCCCUAUGGCGCCCCUGCUGGGCCACUGAUUGUGCCUUAUAACCUGCCUUUGCCUGGGGGAGUGGUGCCUCGCAUGCUGAUAACAAUUCUGGGCACGGUGAAGCCCAAUGCAAACAGAAUUGCUUUAGAUUUCCAAAGAGGGAAUGAUGUUGCCUUCCACUUUAACCCACGCUUCAAUGAGAACAACAGGAGAGUCAUUGUUUGCAAUACAAAGCUGGAUAAUAACUGGGGAAGGGAAGAAAGACAGUCGGUUUUCCCAUUUGAAAGUGGGAAACCAUUCAAAAUACAAGUACUGGUUGAACCUGACCACUUCAAGGUUGCAGUGAAUGAUGCUCACUUGUUGCAGUACAAUCAUCGGGUUAAAAAACUCAAUGAAAUCAGCAAACUGGGAAUUUCUGGUGACAUAGACCUCACCAGUGCUUCAUAUACCAUGAUAUAAUCUGAAAGGGGCAGAUUAAAAAAAAAAAAAGAAUCUAAACCUUACAUGUGUAAAGGUUUCAUGUUCACUGUGAGUGAAAAUUUUUACAUUCAUCAAUAUCCCUCUUGUAAGUCAUCUACUUAAUAAAUAUUACAGUGAAUUACCUGUCUCAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 3958)
galectin 3
strand +
MAC-2, GALIG
NCBI CDS gene sequence (753 bp)
5'-ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTGGCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGGGCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCCTGGAGCACCTGGAGCTTATCCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGACAGCCAAGTGCCACCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATATAA-3'
NCBI CDS gene sequence with introns (location: 55137374.. 55145271) (7898 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 55129252.. 55145423) (16172 bp)Download
NCBI gene sequence (location: [55129252 - 1000].. 55145423) (17172 bp)Download
Cite How to cite