NCBI Summary
The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_000441)
E-selectin
E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
SELE
selectin E
Curated
C-type lectin
SELE
C-type - Selectins
a/b mixed / C-type lectin-like
0.517
Protein sequence and protein families (fasta) (610 amino acids) Download
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
aNeuAc23bGal14(aFuc13)GlcNAc
NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc
References
NCBI References (10 PubMed Identifiers)
  • Single-molecule imaging and microfluidic platform reveal molecular mechanisms of leukemic cell rolling. [34262131]
  • SELE Downregulation Suppresses Mast Cell Accumulation to Protect against Inflammatory Response in Chronic Idiopathic Urticaria. [33285544]
  • L1CAM as an E-selectin Ligand in Colon Cancer. [33167483]
  • Using Eukaryotic Expression Systems to Generate Human alpha1,3-Fucosyltransferases That Effectively Create Selectin-Binding Glycans on Stem Cells. [32901486]
  • Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
  • Cell-cell contact mechanisms. [1375831]
  • Structure and chromosomal location of the gene for endothelial-leukocyte adhesion molecule 1. [1703529]
  • ELAM-1 mediates cell adhesion by recognition of a carbohydrate ligand, sialyl-Lex. [1701274]
  • Genomic organization of the selectin family of leukocyte adhesion molecules on human and mouse chromosome 1. [1694218]
  • Endothelial leukocyte adhesion molecule 1: direct expression cloning and functional interactions. [1689848]
UniProt Main References (17 PubMed Identifiers)
  • Endothelial leukocyte adhesion molecule 1: an inducible receptor for neutrophils related to complement regulatory proteins and lectins. [2466335]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins. [18606703]
  • Glycan Bound to the Selectin Low Affinity State Engages Glu-88 to Stabilize the High Affinity State under Force. [28011641]
  • Modelling the carbohydrate recognition domain of human E-selectin. [7681016]
  • Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains. [7509040]
  • Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1. [11081633]
  • E-selectin ligand complexes adopt an extended high-affinity conformation. [26117840]
  • E-selectin polymorphism and atherosclerosis: an association study. [7533025]
  • Show more
RNA
RNA (Transcript ID: NM_000450.2)
selectin E
m7G-5')ppp(5'-AGCUGUUCUUGGCUGACUUCACAUCAAAACUCCUAUACUGACCUGAGACAGAGGCAGCAGUGAUACCCACCUGAGAGAUCCUGUGUUUGAACAACUGCUUCCCAAAACGGAAAGUAUUUCAAGCCUAAACCUUUGGGUGAAAAGAACUCUUGAAGUCAUGAUUGCUUCACAGUUUCUCUCAGCUCUCACUUUGGUGCUUCUCAUUAAAGAGAGUGGAGCCUGGUCUUACAACACCUCCACGGAAGCUAUGACUUAUGAUGAGGCCAGUGCUUAUUGUCAGCAAAGGUACACACACCUGGUUGCAAUUCAAAACAAAGAAGAGAUUGAGUACCUAAACUCCAUAUUGAGCUAUUCACCAAGUUAUUACUGGAUUGGAAUCAGAAAAGUCAACAAUGUGUGGGUCUGGGUAGGAACCCAGAAACCUCUGACAGAAGAAGCCAAGAACUGGGCUCCAGGUGAACCCAACAAUAGGCAAAAAGAUGAGGACUGCGUGGAGAUCUACAUCAAGAGAGAAAAAGAUGUGGGCAUGUGGAAUGAUGAGAGGUGCAGCAAGAAGAAGCUUGCCCUAUGCUACACAGCUGCCUGUACCAAUACAUCCUGCAGUGGCCACGGUGAAUGUGUAGAGACCAUCAAUAAUUACACUUGCAAGUGUGACCCUGGCUUCAGUGGACUCAAGUGUGAGCAAAUUGUGAACUGUACAGCCCUGGAAUCCCCUGAGCAUGGAAGCCUGGUUUGCAGUCACCCACUGGGAAACUUCAGCUACAAUUCUUCCUGCUCUAUCAGCUGUGAUAGGGGUUACCUGCCAAGCAGCAUGGAGACCAUGCAGUGUAUGUCCUCUGGAGAAUGGAGUGCUCCUAUUCCAGCCUGCAAUGUGGUUGAGUGUGAUGCUGUGACAAAUCCAGCCAAUGGGUUCGUGGAAUGUUUCCAAAACCCUGGAAGCUUCCCAUGGAACACAACCUGUACAUUUGACUGUGAAGAAGGAUUUGAACUAAUGGGAGCCCAGAGCCUUCAGUGUACCUCAUCUGGGAAUUGGGACAACGAGAAGCCAACGUGUAAAGCUGUGACAUGCAGGGCCGUCCGCCAGCCUCAGAAUGGCUCUGUGAGGUGCAGCCAUUCCCCUGCUGGAGAGUUCACCUUCAAAUCAUCCUGCAACUUCACCUGUGAGGAAGGCUUCAUGUUGCAGGGACCAGCCCAGGUUGAAUGCACCACUCAAGGGCAGUGGACACAGCAAAUCCCAGUUUGUGAAGCUUUCCAGUGCACAGCCUUGUCCAACCCCGAGCGAGGCUACAUGAAUUGUCUUCCUAGUGCUUCUGGCAGUUUCCGUUAUGGGUCCAGCUGUGAGUUCUCCUGUGAGCAGGGUUUUGUGUUGAAGGGAUCCAAAAGGCUCCAAUGUGGCCCCACAGGGGAGUGGGACAACGAGAAGCCCACAUGUGAAGCUGUGAGAUGCGAUGCUGUCCACCAGCCCCCGAAGGGUUUGGUGAGGUGUGCUCAUUCCCCUAUUGGAGAAUUCACCUACAAGUCCUCUUGUGCCUUCAGCUGUGAGGAGGGAUUUGAAUUACAUGGAUCAACUCAACUUGAGUGCACAUCUCAGGGACAAUGGACAGAAGAGGUUCCUUCCUGCCAAGUGGUAAAAUGUUCAAGCCUGGCAGUUCCGGGAAAGAUCAACAUGAGCUGCAGUGGGGAGCCCGUGUUUGGCACUGUGUGCAAGUUCGCCUGUCCUGAAGGAUGGACGCUCAAUGGCUCUGCAGCUCGGACAUGUGGAGCCACAGGACACUGGUCUGGCCUGCUACCUACCUGUGAAGCUCCCACUGAGUCCAACAUUCCCUUGGUAGCUGGACUUUCUGCUGCUGGACUCUCCCUCCUGACAUUAGCACCAUUUCUCCUCUGGCUUCGGAAAUGCUUACGGAAAGCAAAGAAAUUUGUUCCUGCCAGCAGCUGCCAAAGCCUUGAAUCAGAUGGAAGCUACCAAAAGCCUUCUUACAUCCUUUAAGUUCAAAAGAAUCAGAAACAGGUGCAUCUGGGGAACUAGAGGGAUACACUGAAGUUAACAGAGACAGAUAACUCUCCUCGGGUCUCUGGCCCUUCUUGCCUACUAUGCCAGAUGCCUUUAUGGCUGAAACCGCAACACCCAUCACCACUUCAAUAGAUCAAAGUCCAGCAGGCAAGGACGGCCUUCAACUGAAAAGACUCAGUGUUCCCUUUCCUACUCUCAGGAUCAAGAAAGUGUUGGCUAAUGAAGGGAAAGGAUAUUUUCUUCCAAGCAAAGGUGAAGAGACCAAGACUCUGAAAUCUCAGAAUUCCUUUUCUAACUCUCCCUUGCUCGCUGUAAAAUCUUGGCACAGAAACACAAUAUUUUGUGGCUUUCUUUCUUUUGCCCUUCACAGUGUUUCGACAGCUGAUUACACAGUUGCUGUCAUAAGAAUGAAUAAUAAUUAUCCAGAGUUUAGAGGAAAAAAAUGACUAAAAAUAUUAUAACUUAAAAAAAUGACAGAUGUUGAAUGCCCACAGGCAAAUGCAUGGAGGGUUGUUAAUGGUGCAAAUCCUACUGAAUGCUCUGUGCGAGGGUUACUAUGCACAAUUUAAUCACUUUCAUCCCUAUGGGAUUCAGUGCUUCUUAAAGAGUUCUUAAGGAUUGUGAUAUUUUUACUUGCAUUGAAUAUAUUAUAAUCUUCCAUACUUCUUCAUUCAAUACAAGUGUGGUAGGGACUUAAAAAACUUGUAAAUGCUGUCAACUAUGAUAUGGUAAAAGUUACUUAUUCUAGAUUACCCCCUCAUUGUUUAUUAACAAAUUAUGUUACAUCUGUUUUAAAUUUAUUUCAAAAAGGGAAACUAUUGUCCCCUAGCAAGGCAUGAUGUUAACCAGAAUAAAGUUCUGAGUGUUUUUACUACAGUUGUUUUUUGAAAACAUGGUAGAAUUGGAGAGUAAAAACUGAAUGGAAGGUUUGUAUAUUGUCAGAUAUUUUUUCAGAAAUAUGUGGUUUCCACGAUGAAAAACUUCCAUGAGGCCAAACGUUUUGAACUAAUAAAAGCAUAAAUGCAAACACACAAAGGUAUAAUUUUAUGAAUGUCUUUGUUGGAAAAGAAUACAGAAAGAUGGAUGUGCUUUGCAUUCCUACAAAGAUGUUUGUCAGAUAUGAUAUGUAAACAUAAUUCUUGUAUAUUAUGGAAGAUUUUAAAUUCACAAUAGAAACUCACCAUGUAAAAGAGUCAUCUGGUAGAUUUUUAACGAAUGAAGAUGUCUAAUAGUUAUUCCCUAUUUGUUUUCUUCUGUAUGUUAGGGUGCUCUGGAAGAGAGGAAUGCCUGUGUGAGCAAGCAUUUAUGUUUAUUUAUAAGCAGAUUUAACAAUUCCAAAGGAAUCUCCAGUUUUCAGUUGAUCACUGGCAAUGAAAAAUUCUCAGUCAGUAAUUGCCAAAGCUGCUCUAGCCUUGAGGAGUGUGAGAAUCAAAACUCUCCUACACUUCCAUUAACUUAGCAUGUGUUGAAAAAAAAGUUUCAGAGAAGUUCUGGCUGAACACUGGCAACAACAAAGCCAACAGUCAAAACAGAGAUGUGAUAAGGAUCAGAACAGCAGAGGUUCUUUUAAAGGGGCAGAAAAACUCUGGGAAAUAAGAGAGAACAACUACUGUGAUCAGGCUAUGUAUGGAAUACAGUGUUAUUUUCUUUGAAAUUGUUUAAGUGUUGUAAAUAUUUAUGUAAACUGCAUUAGAAAUUAGCUGUGUGAAAUACCAGUGUGGUUUGUGUUUGAGUUUUAUUGAGAAUUUUAAAUUAUAACUUAAAAUAUUUUAUAAUUUUUAAAGUAUAUAUUUAUUUAAGCUUAUGUCAGACCUAUUUGACAUAACACUAUAAAGGUUGACAAUAAAUGUGCUUAUGUUUA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 6401)
selectin E
strand -
ESEL, CD62E
NCBI CDS gene sequence (1833 bp)
5'-ATGATTGCTTCACAGTTTCTCTCAGCTCTCACTTTGGTGCTTCTCATTAAAGAGAGTGGAGCCTGGTCTTACAACACCTCCACGGAAGCTATGACTTATGATGAGGCCAGTGCTTATTGTCAGCAAAGGTACACACACCTGGTTGCAATTCAAAACAAAGAAGAGATTGAGTACCTAAACTCCATATTGAGCTATTCACCAAGTTATTACTGGATTGGAATCAGAAAAGTCAACAATGTGTGGGTCTGGGTAGGAACCCAGAAACCTCTGACAGAAGAAGCCAAGAACTGGGCTCCAGGTGAACCCAACAATAGGCAAAAAGATGAGGACTGCGTGGAGATCTACATCAAGAGAGAAAAAGATGTGGGCATGTGGAATGATGAGAGGTGCAGCAAGAAGAAGCTTGCCCTATGCTACACAGCTGCCTGTACCAATACATCCTGCAGTGGCCACGGTGAATGTGTAGAGACCATCAATAATTACACTTGCAAGTGTGACCCTGGCTTCAGTGGACTCAAGTGTGAGCAAATTGTGAACTGTACAGCCCTGGAATCCCCTGAGCATGGAAGCCTGGTTTGCAGTCACCCACTGGGAAACTTCAGCTACAATTCTTCCTGCTCTATCAGCTGTGATAGGGGTTACCTGCCAAGCAGCATGGAGACCATGCAGTGTATGTCCTCTGGAGAATGGAGTGCTCCTATTCCAGCCTGCAATGTGGTTGAGTGTGATGCTGTGACAAATCCAGCCAATGGGTTCGTGGAATGTTTCCAAAACCCTGGAAGCTTCCCATGGAACACAACCTGTACATTTGACTGTGAAGAAGGATTTGAACTAATGGGAGCCCAGAGCCTTCAGTGTACCTCATCTGGGAATTGGGACAACGAGAAGCCAACGTGTAAAGCTGTGACATGCAGGGCCGTCCGCCAGCCTCAGAATGGCTCTGTGAGGTGCAGCCATTCCCCTGCTGGAGAGTTCACCTTCAAATCATCCTGCAACTTCACCTGTGAGGAAGGCTTCATGTTGCAGGGACCAGCCCAGGTTGAATGCACCACTCAAGGGCAGTGGACACAGCAAATCCCAGTTTGTGAAGCTTTCCAGTGCACAGCCTTGTCCAACCCCGAGCGAGGCTACATGAATTGTCTTCCTAGTGCTTCTGGCAGTTTCCGTTATGGGTCCAGCTGTGAGTTCTCCTGTGAGCAGGGTTTTGTGTTGAAGGGATCCAAAAGGCTCCAATGTGGCCCCACAGGGGAGTGGGACAACGAGAAGCCCACATGTGAAGCTGTGAGATGCGATGCTGTCCACCAGCCCCCGAAGGGTTTGGTGAGGTGTGCTCATTCCCCTATTGGAGAATTCACCTACAAGTCCTCTTGTGCCTTCAGCTGTGAGGAGGGATTTGAATTACATGGATCAACTCAACTTGAGTGCACATCTCAGGGACAATGGACAGAAGAGGTTCCTTCCTGCCAAGTGGTAAAATGTTCAAGCCTGGCAGTTCCGGGAAAGATCAACATGAGCTGCAGTGGGGAGCCCGTGTTTGGCACTGTGTGCAAGTTCGCCTGTCCTGAAGGATGGACGCTCAATGGCTCTGCAGCTCGGACATGTGGAGCCACAGGACACTGGTCTGGCCTGCTACCTACCTGTGAAGCTCCCACTGAGTCCAACATTCCCTTGGTAGCTGGACTTTCTGCTGCTGGACTCTCCCTCCTGACATTAGCACCATTTCTCCTCTGGCTTCGGAAATGCTTACGGAAAGCAAAGAAATTTGTTCCTGCCAGCAGCTGCCAAAGCCTTGAATCAGATGGAAGCTACCAAAAGCCTTCTTACATCCTTTAA-3'
NCBI CDS gene sequence with introns (location: 169725744.. 169733612) (7869 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 169722640.. 169734079) (11440 bp)Download
NCBI gene sequence (location: [169722640.. 169734079 + 1000]) (12440 bp)Download
Cite How to cite