NCBI Summary
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011].
Protein
Protein (NP_001993)
Fc fragment of IgE receptor II
Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form]
FCER2
Fc epsilon receptor II
CD23
Very low evidence
C-type lectin
Undefined
C-type - Type II transmembrane receptors
a/b mixed / C-type lectin-like
Human one does not bind sugar
NP_001993
2208
P06734
Undefined
P06734
0.425
10.1074/jbc.RA119.010572
PFAM, InterPro
Protein sequence and protein families (fasta) (321 amino acids) Download
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Mol* PDB structure viewerUniLectin3D
Structural models
AlphaFold v2: AF-P06734-F1Download
  Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Homotrimer. Interacts (via C-type lectin domain) with IGHE (via CH3 region); this interaction regulates IgE homeostasis. Interacts (via the C-terminus) with CR2/CD21 (via Sushi domain 1 and 2) (PubMed:1386409, PubMed:16172256)
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Human Protein Atlas
GeneCards
Functionality temporarily unavailable.
ProteomicsDB
References
NCBI References (10 PubMed Identifiers)
  • Plasmablasts derive from CD23- activated B cells after the extinction of IL-4/STAT6 signaling and IRF4 induction. [33150420]
  • CD23 mediated the induction of pro-inflammatory cytokines Interleukin-1 beta and tumor necrosis factors-alpha in Aspergillus fumigatus keratitis. [33470651]
  • Correlations between exhaled nitric oxide, rs28364072 polymorphism of FCER2 gene, asthma control, and inhaled corticosteroid responsiveness in children with asthma. [33108776]
  • Intracellular trafficking of CD23: differential regulation in humans and mice by both extracellular and intracellular exons. [15843555]
  • Pax-5 is a key regulator of the B cell-restricted expression of the CD23a isoform. [12731041]
  • The CD23b promoter is a target for NF-AT transcription factors in B-CLL cells. [12379312]
  • The CD23a and CD23b proximal promoters display different sensitivities to exogenous stimuli in B lymphocytes. [12070780]
  • Partial characterization of natural and recombinant human soluble CD23. [1417742]
  • Induction of Fc epsilon RII/CD23 on PHA-activated human peripheral blood T lymphocytes and the association of Fyn tyrosine kinase with Fc epsilon RII/CD23. [1387715]
  • Cloning and expression of the cDNA coding for a human lymphocyte IgE receptor. [3034567]
UniProt Main References (12 PubMed Identifiers)
  • Human lymphocyte Fc receptor for IgE: sequence homology of its cloned cDNA with animal lectins. [2949326]
  • Molecular structure of human lymphocyte receptor for immunoglobulin E. [2877743]
  • The DNA sequence and biology of human chromosome 19. [15057824]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Two species of human Fc epsilon receptor II (Fc epsilon RII/CD23): tissue-specific and IL-4-specific regulation of gene expression. [2972386]
  • The low affinity IgE receptor (CD23) is cleaved by the metalloproteinase ADAM10. [17389606]
  • Proteomic analysis of S-acylated proteins in human B cells reveals palmitoylation of the immune regulators CD20 and CD23. [22615937]
  • Modeling of the lectin-homology domains of the human and murine low-affinity Fc epsilon receptor (Fc epsilon RII/CD23). [8142907]
  • Structure-based modeling of the ligand binding domain of the human cell surface receptor CD23 and comparison of two independently derived molecular models. [8745401]
  • The structure of human CD23 and its interactions with IgE and CD21. [16172256]
    • Show more
All isoforms of this gene containing a lectin domain
NP_001193948.2, NP_001207429.1, NP_001993.2, XP_005272519.1
RNA
RNA (Transcript ID: NM_002002.5)
NM_002002.5
Fc epsilon receptor II, transcript variant 1
All isoforms of FCER2 containing a lectin domain
199..1164 (or 7689193.. 7699760)
7688776.. 7702131
NCBI Matured mRNA sequence 1581 NTPDownload 
m7G-5')ppp(5'-AGAAGAAAGUGUCUCUCUUCCUGCUUAAACCUCUGUCUCUGACGGUCCCUGCCAAUCGCUCUGGUCGACCCCAACACACUAGGAGGACAGACACAGGCUCCAAACUCCACUAACCAGAGCUGUGAUUGUGCCCGCUGAGUGGACUGCGUUGUCAGGGAGUGAGUGCUCCAUCAUCGGGAGAAUCCAAGCAGGACCGCCAUGGAGGAAGGUCAAUAUUCAGAGAUCGAGGAGCUUCCCAGGAGGCGGUGUUGCAGGCGUGGGACUCAGAUCGUGCUGCUGGGGCUGGUGACCGCCGCUCUGUGGGCUGGGCUGCUGACUCUGCUUCUCCUGUGGCACUGGGACACCACACAGAGUCUAAAACAGCUGGAAGAGAGGGCUGCCCGGAACGUCUCUCAAGUUUCCAAGAACUUGGAAAGCCACCACGGUGACCAGAUGGCGCAGAAAUCCCAGUCCACGCAGAUUUCACAGGAACUGGAGGAACUUCGAGCUGAACAGCAGAGAUUGAAAUCUCAGGACUUGGAGCUGUCCUGGAACCUGAACGGGCUUCAAGCAGAUCUGAGCAGCUUCAAGUCCCAGGAAUUGAACGAGAGGAACGAAGCUUCAGAUUUGCUGGAAAGACUCCGGGAGGAGGUGACAAAGCUAAGGAUGGAGUUGCAGGUGUCCAGCGGCUUUGUGUGCAACACGUGCCCUGAAAAGUGGAUCAAUUUCCAACGGAAGUGCUACUACUUCGGCAAGGGCACCAAGCAGUGGGUCCACGCCCGGUAUGCCUGUGACGACAUGGAAGGGCAGCUGGUCAGCAUCCACAGCCCGGAGGAGCAGGACUUCCUGACCAAGCAUGCCAGCCACACCGGCUCCUGGAUUGGCCUUCGGAACUUGGACCUGAAGGGGGAGUUUAUCUGGGUGGAUGGGAGCCACGUGGACUACAGCAACUGGGCUCCAGGGGAGCCCACCAGCCGGAGCCAGGGCGAGGACUGCGUGAUGAUGCGGGGCUCCGGUCGCUGGAACGACGCCUUCUGCGACCGUAAGCUGGGCGCCUGGGUGUGCGACCGGCUGGCCACAUGCACGCCGCCAGCCAGCGAAGGUUCCGCGGAGUCCAUGGGACCUGAUUCAAGACCAGACCCUGACGGCCGCCUGCCCACCCCCUCUGCCCCUCUCCACUCUUGAGCAUGGAUACAGCCAGGCCCAGAGCAAGACCCUGAAGACCCCCAACCACGGCCUAAAAGCCUCUUUGUGGCUGAAAGGUCCCUGUGACAUUUUCUGCCACCCAAACGGAGGCAGCUGACACAUCUCCCGCUCCUCUAUGGCCCCUGCCUUCCCAGGAGUACACCCCAACAGCACCCUCUCCAGAUGGGAGUGCCCCCAACAGCACCCUCUCCAGAUGAGAGUACACCCCAACAGCACCCUCUCCAGAUGAGAGUACACCCCAACAGCACCCUCUCCAGAUGAGAGUACACCCCAACAGCACCCUCUCCAGAUGCAGCCCCAUCUCCUCAGCACCCCAGGACCUGAGUAUCCCCAGCUCAGGUGGUGAGUCCUCCUGUCCAGCCUGCAUCAAUAAAAUGGGGCAGUGAUGGCCUCCCA-3'- Poly-A tail
  • Coding region
mRNA-related data
DNA
DNA (Gene ID: 2208)
FCER2
Fc epsilon receptor II
NC_000019.10
19  7689193.. 7699760
7689193.. 7699760
strand -
CCDS12184.1
MGI:95497
ClinVar, dbVar
ENSG00000104921
CLEC4J, CD23, FCErII, FcepsilonRII
uc002mhm.3
INSDC: M15059
3612
151445
OTTHUMG00000182517
ENA, DDBJ, Monarch
CD23
Gene-related data
NCBI CDS gene sequence (966 bp)
5'-ATGGAGGAAGGTCAATATTCAGAGATCGAGGAGCTTCCCAGGAGGCGGTGTTGCAGGCGTGGGACTCAGATCGTGCTGCTGGGGCTGGTGACCGCCGCTCTGTGGGCTGGGCTGCTGACTCTGCTTCTCCTGTGGCACTGGGACACCACACAGAGTCTAAAACAGCTGGAAGAGAGGGCTGCCCGGAACGTCTCTCAAGTTTCCAAGAACTTGGAAAGCCACCACGGTGACCAGATGGCGCAGAAATCCCAGTCCACGCAGATTTCACAGGAACTGGAGGAACTTCGAGCTGAACAGCAGAGATTGAAATCTCAGGACTTGGAGCTGTCCTGGAACCTGAACGGGCTTCAAGCAGATCTGAGCAGCTTCAAGTCCCAGGAATTGAACGAGAGGAACGAAGCTTCAGATTTGCTGGAAAGACTCCGGGAGGAGGTGACAAAGCTAAGGATGGAGTTGCAGGTGTCCAGCGGCTTTGTGTGCAACACGTGCCCTGAAAAGTGGATCAATTTCCAACGGAAGTGCTACTACTTCGGCAAGGGCACCAAGCAGTGGGTCCACGCCCGGTATGCCTGTGACGACATGGAAGGGCAGCTGGTCAGCATCCACAGCCCGGAGGAGCAGGACTTCCTGACCAAGCATGCCAGCCACACCGGCTCCTGGATTGGCCTTCGGAACTTGGACCTGAAGGGGGAGTTTATCTGGGTGGATGGGAGCCACGTGGACTACAGCAACTGGGCTCCAGGGGAGCCCACCAGCCGGAGCCAGGGCGAGGACTGCGTGATGATGCGGGGCTCCGGTCGCTGGAACGACGCCTTCTGCGACCGTAAGCTGGGCGCCTGGGTGTGCGACCGGCTGGCCACATGCACGCCGCCAGCCAGCGAAGGTTCCGCGGAGTCCATGGGACCTGATTCAAGACCAGACCCTGACGGCCGCCTGCCCACCCCCTCTGCCCCTCTCCACTCTTGA-3'
NCBI CDS gene sequence with introns (location: 7689193.. 7699760) (10568 bp)Download
NCBI Gene Viewer (CDS + introns)
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 7688776.. 7702131) (13356 bp)Download
NCBI Gene Viewer (CDS + introns + Untranslated regions)
NCBI gene sequence (location: [7688776.. 7702131 + 1000]) (14356 bp)Download
NCBI Gene Viewer (CDS + introns + Untranslated regions + 1000 dNTP to potentially reach the promotor)
Cite How to cite