NCBI Summary
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011].
Protein
Protein (NP_001993)
Fc fragment of IgE receptor II
Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form]
FCER2
Fc epsilon receptor II
Very low evidence
C-type lectin
Undefined
C-type - Type II transmembrane receptors
a/b mixed / C-type lectin-like
Human one does not bind sugar
Undefined
0.425
Protein sequence and protein families (fasta) (321 amino acids) Download
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Plasmablasts derive from CD23- activated B cells after the extinction of IL-4/STAT6 signaling and IRF4 induction. [33150420]
  • CD23 mediated the induction of pro-inflammatory cytokines Interleukin-1 beta and tumor necrosis factors-alpha in Aspergillus fumigatus keratitis. [33470651]
  • Correlations between exhaled nitric oxide, rs28364072 polymorphism of FCER2 gene, asthma control, and inhaled corticosteroid responsiveness in children with asthma. [33108776]
  • Intracellular trafficking of CD23: differential regulation in humans and mice by both extracellular and intracellular exons. [15843555]
  • Pax-5 is a key regulator of the B cell-restricted expression of the CD23a isoform. [12731041]
  • The CD23b promoter is a target for NF-AT transcription factors in B-CLL cells. [12379312]
  • The CD23a and CD23b proximal promoters display different sensitivities to exogenous stimuli in B lymphocytes. [12070780]
  • Partial characterization of natural and recombinant human soluble CD23. [1417742]
  • Induction of Fc epsilon RII/CD23 on PHA-activated human peripheral blood T lymphocytes and the association of Fyn tyrosine kinase with Fc epsilon RII/CD23. [1387715]
  • Cloning and expression of the cDNA coding for a human lymphocyte IgE receptor. [3034567]
UniProt Main References (12 PubMed Identifiers)
  • Human lymphocyte Fc receptor for IgE: sequence homology of its cloned cDNA with animal lectins. [2949326]
  • Molecular structure of human lymphocyte receptor for immunoglobulin E. [2877743]
  • The DNA sequence and biology of human chromosome 19. [15057824]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Two species of human Fc epsilon receptor II (Fc epsilon RII/CD23): tissue-specific and IL-4-specific regulation of gene expression. [2972386]
  • The low affinity IgE receptor (CD23) is cleaved by the metalloproteinase ADAM10. [17389606]
  • Proteomic analysis of S-acylated proteins in human B cells reveals palmitoylation of the immune regulators CD20 and CD23. [22615937]
  • Modeling of the lectin-homology domains of the human and murine low-affinity Fc epsilon receptor (Fc epsilon RII/CD23). [8142907]
  • Structure-based modeling of the ligand binding domain of the human cell surface receptor CD23 and comparison of two independently derived molecular models. [8745401]
  • The structure of human CD23 and its interactions with IgE and CD21. [16172256]
  • Show more
All isoforms of this gene containing a lectin domain
NP_001193948.2, NP_001207429.1, NP_001993.2, XP_005272519.1
RNA
RNA (Transcript ID: NM_002002.5)
Fc epsilon receptor II, transcript variant 1
m7G-5')ppp(5'-AGAAGAAAGUGUCUCUCUUCCUGCUUAAACCUCUGUCUCUGACGGUCCCUGCCAAUCGCUCUGGUCGACCCCAACACACUAGGAGGACAGACACAGGCUCCAAACUCCACUAACCAGAGCUGUGAUUGUGCCCGCUGAGUGGACUGCGUUGUCAGGGAGUGAGUGCUCCAUCAUCGGGAGAAUCCAAGCAGGACCGCCAUGGAGGAAGGUCAAUAUUCAGAGAUCGAGGAGCUUCCCAGGAGGCGGUGUUGCAGGCGUGGGACUCAGAUCGUGCUGCUGGGGCUGGUGACCGCCGCUCUGUGGGCUGGGCUGCUGACUCUGCUUCUCCUGUGGCACUGGGACACCACACAGAGUCUAAAACAGCUGGAAGAGAGGGCUGCCCGGAACGUCUCUCAAGUUUCCAAGAACUUGGAAAGCCACCACGGUGACCAGAUGGCGCAGAAAUCCCAGUCCACGCAGAUUUCACAGGAACUGGAGGAACUUCGAGCUGAACAGCAGAGAUUGAAAUCUCAGGACUUGGAGCUGUCCUGGAACCUGAACGGGCUUCAAGCAGAUCUGAGCAGCUUCAAGUCCCAGGAAUUGAACGAGAGGAACGAAGCUUCAGAUUUGCUGGAAAGACUCCGGGAGGAGGUGACAAAGCUAAGGAUGGAGUUGCAGGUGUCCAGCGGCUUUGUGUGCAACACGUGCCCUGAAAAGUGGAUCAAUUUCCAACGGAAGUGCUACUACUUCGGCAAGGGCACCAAGCAGUGGGUCCACGCCCGGUAUGCCUGUGACGACAUGGAAGGGCAGCUGGUCAGCAUCCACAGCCCGGAGGAGCAGGACUUCCUGACCAAGCAUGCCAGCCACACCGGCUCCUGGAUUGGCCUUCGGAACUUGGACCUGAAGGGGGAGUUUAUCUGGGUGGAUGGGAGCCACGUGGACUACAGCAACUGGGCUCCAGGGGAGCCCACCAGCCGGAGCCAGGGCGAGGACUGCGUGAUGAUGCGGGGCUCCGGUCGCUGGAACGACGCCUUCUGCGACCGUAAGCUGGGCGCCUGGGUGUGCGACCGGCUGGCCACAUGCACGCCGCCAGCCAGCGAAGGUUCCGCGGAGUCCAUGGGACCUGAUUCAAGACCAGACCCUGACGGCCGCCUGCCCACCCCCUCUGCCCCUCUCCACUCUUGAGCAUGGAUACAGCCAGGCCCAGAGCAAGACCCUGAAGACCCCCAACCACGGCCUAAAAGCCUCUUUGUGGCUGAAAGGUCCCUGUGACAUUUUCUGCCACCCAAACGGAGGCAGCUGACACAUCUCCCGCUCCUCUAUGGCCCCUGCCUUCCCAGGAGUACACCCCAACAGCACCCUCUCCAGAUGGGAGUGCCCCCAACAGCACCCUCUCCAGAUGAGAGUACACCCCAACAGCACCCUCUCCAGAUGAGAGUACACCCCAACAGCACCCUCUCCAGAUGAGAGUACACCCCAACAGCACCCUCUCCAGAUGCAGCCCCAUCUCCUCAGCACCCCAGGACCUGAGUAUCCCCAGCUCAGGUGGUGAGUCCUCCUGUCCAGCCUGCAUCAAUAAAAUGGGGCAGUGAUGGCCUCCCA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 2208)
Fc epsilon receptor II
strand -
CLEC4J, CD23, FCErII, FcepsilonRII
NCBI CDS gene sequence (966 bp)
5'-ATGGAGGAAGGTCAATATTCAGAGATCGAGGAGCTTCCCAGGAGGCGGTGTTGCAGGCGTGGGACTCAGATCGTGCTGCTGGGGCTGGTGACCGCCGCTCTGTGGGCTGGGCTGCTGACTCTGCTTCTCCTGTGGCACTGGGACACCACACAGAGTCTAAAACAGCTGGAAGAGAGGGCTGCCCGGAACGTCTCTCAAGTTTCCAAGAACTTGGAAAGCCACCACGGTGACCAGATGGCGCAGAAATCCCAGTCCACGCAGATTTCACAGGAACTGGAGGAACTTCGAGCTGAACAGCAGAGATTGAAATCTCAGGACTTGGAGCTGTCCTGGAACCTGAACGGGCTTCAAGCAGATCTGAGCAGCTTCAAGTCCCAGGAATTGAACGAGAGGAACGAAGCTTCAGATTTGCTGGAAAGACTCCGGGAGGAGGTGACAAAGCTAAGGATGGAGTTGCAGGTGTCCAGCGGCTTTGTGTGCAACACGTGCCCTGAAAAGTGGATCAATTTCCAACGGAAGTGCTACTACTTCGGCAAGGGCACCAAGCAGTGGGTCCACGCCCGGTATGCCTGTGACGACATGGAAGGGCAGCTGGTCAGCATCCACAGCCCGGAGGAGCAGGACTTCCTGACCAAGCATGCCAGCCACACCGGCTCCTGGATTGGCCTTCGGAACTTGGACCTGAAGGGGGAGTTTATCTGGGTGGATGGGAGCCACGTGGACTACAGCAACTGGGCTCCAGGGGAGCCCACCAGCCGGAGCCAGGGCGAGGACTGCGTGATGATGCGGGGCTCCGGTCGCTGGAACGACGCCTTCTGCGACCGTAAGCTGGGCGCCTGGGTGTGCGACCGGCTGGCCACATGCACGCCGCCAGCCAGCGAAGGTTCCGCGGAGTCCATGGGACCTGATTCAAGACCAGACCCTGACGGCCGCCTGCCCACCCCCTCTGCCCCTCTCCACTCTTGA-3'
NCBI CDS gene sequence with introns (location: 7689193.. 7699760) (10568 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 7688776.. 7702131) (13356 bp)Download
NCBI gene sequence (location: [7688776.. 7702131 + 1000]) (14356 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905