NCBI Summary
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_001819)
Galectin 10 / Charcot-Leyden crystal galectin
Galectin-10 (Gal-10) (Charcot-Leyden crystal protein) (CLC) (Eosinophil lysophospholipase) (Lysolecithin acylhydrolase)
CLC
Charcot-Leyden crystal galectin
Undefined
Low evidence
galectin-like
S-Type Lectins - Prototypical
b-sandwich / ConA-like
0.455
Protein sequence and protein families (fasta) (142 amino acids) Download
MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Interacts with CEL. Source: UniProt
Annotation
Ligand
Glycan ligands from structural data
Gal(b1-4)Glc
ribose
Rib
Man
Man
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • Identification of galectin-10 as a biomarker for periodontitis based on proteomic analysis of gingival crevicular fluid. [33300083]
  • [Expression and pathological role of galectin-10 in different types of nasal polyps]. [32911886]
  • Galectin-10, the protein that forms Charcot-Leyden crystals, is not stored in granules but resides in the peripheral cytoplasm of human eosinophils. [32108369]
  • A reference map of the human binary protein interactome. [32296183]
  • Predictive Significance of Charcot-Leyden Crystals for Eosinophilic Chronic Rhinosinusitis With Nasal Polyps. [31269798]
  • Localization of the human eosinophil Charcot-Leyden crystal protein (lysophospholipase) gene (CLC) to chromosome 19 and the human ribonuclease 2 (eosinophil-derived neurotoxin) and ribonuclease 3 (eosinophil cationic protein) genes (RNS2 and RNS3) to chromosome 14. [1577491]
  • Charcot-Leyden crystal protein in the degranulation and recovery of activated basophils. [1373430]
  • Ultrastructural localization of Charcot-Leyden crystal protein (lysophospholipase) to intracytoplasmic crystals in tumor cells of primary solid and papillary epithelial neoplasm of the pancreas. [2160563]
  • Ultrastructural localization of Charcot-Leyden crystal protein (lysophospholipase) and peroxidase in macrophages, eosinophils, and extracellular matrix of the skin in the hypereosinophilic syndrome. [2160562]
  • Comparative properties of the Charcot-Leyden crystal protein and the major basic protein from human eosinophils. [942977]
UniProt Main References (13 PubMed Identifiers)
  • Molecular cloning and characterization of human eosinophil Charcot-Leyden crystal protein (lysophospholipase). Similarities to IgE binding proteins and the S-type animal lectin superfamily. [8419478]
  • The genomic structure of the human Charcot-Leyden crystal protein gene is analogous to those of the galectin genes. [9119387]
  • A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. [19497882]
  • The DNA sequence and biology of human chromosome 19. [15057824]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Comparative proteomics of nasal fluid in seasonal allergic rhinitis. [16457599]
  • Human CD4+CD25+ regulatory T cells: proteome analysis identifies galectin-10 as a novel marker essential for their anergy and suppressive function. [17502455]
  • Galectin-10, eosinophils, and celiac disease. [19758173]
  • Galectin-10, a potential biomarker of eosinophilic airway inflammation. [22880030]
  • An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. [24275569]
  • Show more
RNA
RNA (Transcript ID: NM_001828.6)
Charcot-Leyden crystal galectin
m7G-5')ppp(5'-CAUUUAAAUUCUGCAGCUCAGAGAUUCACACAGAAGUCUGGACACAAUUCAGAAGAGCCACCCAGAAGGAGACAACAAUGUCCCUGCUACCCGUGCCAUACACAGAGGCUGCCUCUUUGUCUACUGGUUCUACUGUGACAAUCAAAGGGCGACCACUUGCCUGUUUCUUGAAUGAACCAUAUCUGCAGGUGGAUUUCCACACUGAGAUGAAGGAGGAAUCAGACAUUGUCUUCCAUUUCCAAGUGUGCUUUGGUCGUCGUGUGGUCAUGAACAGCCGUGAGUAUGGGGCCUGGAAGCAGCAGGUGGAAUCCAAGAAUAUGCCCUUUCAGGAUGGCCAAGAAUUUGAACUGAGCAUCUCAGUGCUGCCAGAUAAGUACCAGGUAAUGGUCAAUGGCCAAUCCUCUUACACCUUUGACCAUAGAAUCAAGCCUGAGGCUGUGAAGAUGGUGCAAGUGUGGAGAGAUAUCUCCCUGACCAAAUUUAAUGUCAGCUAUUUAAAGAGAUAACCAGACUUCAUGUUGCCAAGGAAUCCCUGUCUCUACGUGAACUUGGGAUUCCAAAGCCAGCUAACAGCAUGAUCUUUUCUCACUUCAAUCCUUACUCCUGCUCAUUAAAACUUAAUCAAACUUCA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 1178)
CLC
Charcot-Leyden crystal galectin
strand -
LGALS10, MGC149659, Gal-10
NCBI CDS gene sequence (429 bp)
5'-ATGTCCCTGCTACCCGTGCCATACACAGAGGCTGCCTCTTTGTCTACTGGTTCTACTGTGACAATCAAAGGGCGACCACTTGCCTGTTTCTTGAATGAACCATATCTGCAGGTGGATTTCCACACTGAGATGAAGGAGGAATCAGACATTGTCTTCCATTTCCAAGTGTGCTTTGGTCGTCGTGTGGTCATGAACAGCCGTGAGTATGGGGCCTGGAAGCAGCAGGTGGAATCCAAGAATATGCCCTTTCAGGATGGCCAAGAATTTGAACTGAGCATCTCAGTGCTGCCAGATAAGTACCAGGTAATGGTCAATGGCCAATCCTCTTACACCTTTGACCATAGAATCAAGCCTGAGGCTGTGAAGATGGTGCAAGTGTGGAGAGATATCTCCCTGACCAAATTTAATGTCAGCTATTTAAAGAGATAA-3'
NCBI CDS gene sequence with introns (location: 39731380.. 39737952) (6573 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 39731255.. 39738029) (6775 bp)Download
NCBI gene sequence (location: [39731255.. 39738029 + 1000]) (7775 bp)Download
Cite How to cite