NCBI Summary
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_001819)
Galectin 10 / Charcot-Leyden crystal galectin
Galectin-10 (Gal-10) (Charcot-Leyden crystal protein) (CLC) (Eosinophil lysophospholipase) (Lysolecithin acylhydrolase)
CLC
Charcot-Leyden crystal galectin
Undefined
Low evidence
galectin-like
S-Type Lectins - Prototypical
b-sandwich / ConA-like
MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Mol* PDB structure viewerUniLectin3D
Ligand
Glycan ligands from structural data
References
NCBI References (10 PubMed Identifiers)
- Identification of galectin-10 as a biomarker for periodontitis based on proteomic analysis of gingival crevicular fluid. [33300083]
- [Expression and pathological role of galectin-10 in different types of nasal polyps]. [32911886]
- Galectin-10, the protein that forms Charcot-Leyden crystals, is not stored in granules but resides in the peripheral cytoplasm of human eosinophils. [32108369]
- A reference map of the human binary protein interactome. [32296183]
- Predictive Significance of Charcot-Leyden Crystals for Eosinophilic Chronic Rhinosinusitis With Nasal Polyps. [31269798]
- Localization of the human eosinophil Charcot-Leyden crystal protein (lysophospholipase) gene (CLC) to chromosome 19 and the human ribonuclease 2 (eosinophil-derived neurotoxin) and ribonuclease 3 (eosinophil cationic protein) genes (RNS2 and RNS3) to chromosome 14. [1577491]
- Charcot-Leyden crystal protein in the degranulation and recovery of activated basophils. [1373430]
- Ultrastructural localization of Charcot-Leyden crystal protein (lysophospholipase) to intracytoplasmic crystals in tumor cells of primary solid and papillary epithelial neoplasm of the pancreas. [2160563]
- Ultrastructural localization of Charcot-Leyden crystal protein (lysophospholipase) and peroxidase in macrophages, eosinophils, and extracellular matrix of the skin in the hypereosinophilic syndrome. [2160562]
- Comparative properties of the Charcot-Leyden crystal protein and the major basic protein from human eosinophils. [942977]
UniProt Main References (13 PubMed Identifiers)
- Molecular cloning and characterization of human eosinophil Charcot-Leyden crystal protein (lysophospholipase). Similarities to IgE binding proteins and the S-type animal lectin superfamily. [8419478]
- The genomic structure of the human Charcot-Leyden crystal protein gene is analogous to those of the galectin genes. [9119387]
- A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. [19497882]
- The DNA sequence and biology of human chromosome 19. [15057824]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Comparative proteomics of nasal fluid in seasonal allergic rhinitis. [16457599]
- Human CD4+CD25+ regulatory T cells: proteome analysis identifies galectin-10 as a novel marker essential for their anergy and suppressive function. [17502455]
- Galectin-10, eosinophils, and celiac disease. [19758173]
- Galectin-10, a potential biomarker of eosinophilic airway inflammation. [22880030]
- An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. [24275569] Show more
RNA
RNA (Transcript ID: NM_001828.6)
m7G-5')ppp(5'-CAUUUAAAUUCUGCAGCUCAGAGAUUCACACAGAAGUCUGGACACAAUUCAGAAGAGCCACCCAGAAGGAGACAACAAUGUCCCUGCUACCCGUGCCAUACACAGAGGCUGCCUCUUUGUCUACUGGUUCUACUGUGACAAUCAAAGGGCGACCACUUGCCUGUUUCUUGAAUGAACCAUAUCUGCAGGUGGAUUUCCACACUGAGAUGAAGGAGGAAUCAGACAUUGUCUUCCAUUUCCAAGUGUGCUUUGGUCGUCGUGUGGUCAUGAACAGCCGUGAGUAUGGGGCCUGGAAGCAGCAGGUGGAAUCCAAGAAUAUGCCCUUUCAGGAUGGCCAAGAAUUUGAACUGAGCAUCUCAGUGCUGCCAGAUAAGUACCAGGUAAUGGUCAAUGGCCAAUCCUCUUACACCUUUGACCAUAGAAUCAAGCCUGAGGCUGUGAAGAUGGUGCAAGUGUGGAGAGAUAUCUCCCUGACCAAAUUUAAUGUCAGCUAUUUAAAGAGAUAACCAGACUUCAUGUUGCCAAGGAAUCCCUGUCUCUACGUGAACUUGGGAUUCCAAAGCCAGCUAACAGCAUGAUCUUUUCUCACUUCAAUCCUUACUCCUGCUCAUUAAAACUUAAUCAAACUUCA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 1178)
Charcot-Leyden crystal galectin
strand -
LGALS10, MGC149659, Gal-10
NCBI CDS gene sequence (429 bp)
5'-ATGTCCCTGCTACCCGTGCCATACACAGAGGCTGCCTCTTTGTCTACTGGTTCTACTGTGACAATCAAAGGGCGACCACTTGCCTGTTTCTTGAATGAACCATATCTGCAGGTGGATTTCCACACTGAGATGAAGGAGGAATCAGACATTGTCTTCCATTTCCAAGTGTGCTTTGGTCGTCGTGTGGTCATGAACAGCCGTGAGTATGGGGCCTGGAAGCAGCAGGTGGAATCCAAGAATATGCCCTTTCAGGATGGCCAAGAATTTGAACTGAGCATCTCAGTGCTGCCAGATAAGTACCAGGTAATGGTCAATGGCCAATCCTCTTACACCTTTGACCATAGAATCAAGCCTGAGGCTGTGAAGATGGTGCAAGTGTGGAGAGATATCTCCCTGACCAAATTTAATGTCAGCTATTTAAAGAGATAA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.