NCBI Summary
This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq, Sep 2013].
Protein
Protein (NP_647475)
Angiopoietin-related protein 4
Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]
ANGPTL4
angiopoietin like 4
Undefined
Very low evidence
Ficolin-like
Undefined
a/b mixed with b-sheet / Fibrinogen C-ter like
Uncharacterised
0.532
Undefined
Protein sequence and protein families (fasta) (406 amino acids) Download
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Differential Expression of the Host Lipid Regulators ANGPTL-3 and ANGPTL-4 in HCV Infection and Treatment. [34360721]
  • Association between ANGPTL3, 4, and 8 and lipid and glucose metabolism markers in patients with diabetes. [34293055]
  • Angiopoietin-like protein 4: health effects, modulating agents and structure-function relationships. [22462789]
  • Proteolytic processing of angiopoietin-like protein 4 by proprotein convertases modulates its inhibitory effects on lipoprotein lipase activity. [21398697]
  • Suppression of the Raf/MEK/ERK signaling cascade and inhibition of angiogenesis by the carboxyl terminus of angiopoietin-like protein 4. [18340008]
  • Inhibition of angiogenesis and vascular leakiness by angiopoietin-related protein 4. [14583458]
  • Identification of silencing of nine genes in human gastric cancers. [12438262]
  • [Cloning of a novel gene, ANGPTL4 and the functional study in angiogenesis]. [11953136]
  • Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation. [10866690]
  • Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis. [10698685]
UniProt Main References (12 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and biology of human chromosome 19. [15057824]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • [Expression and function of hepatocellular carcinoma-related gene pp1158]. [12015030]
  • Extracellular matrix-bound angiopoietin-like 4 inhibits endothelial cell adhesion, migration, and sprouting and alters actin cytoskeleton. [17068295]
  • Genetic variation in ANGPTL4 provides insights into protein processing and function. [19270337]
  • The angiopoietin-like protein ANGPTL4 catalyzes unfolding of the hydrolase domain in lipoprotein lipase and the endothelial membrane protein GPIHBP1 counteracts this unfolding. [27929370]
  • A disordered acidic domain in GPIHBP1 harboring a sulfated tyrosine regulates lipoprotein lipase. [29899144]
  • Structures of Angptl3 and Angptl4, modulators of triglyceride levels and coronary artery disease. [29713054]
  • Show more
All isoforms of this gene containing a lectin domain
NP_647475.1, XP_005272541.1, NP_001034756.1, XP_005272542.1
RNA
RNA (Transcript ID: NM_139314.3)
angiopoietin like 4, transcript variant 1
m7G-5')ppp(5'-AGAAGCCGAGCUGAGCGGAUCCUCACACGACUGUGAUCCGAUUCUUUCCAGCGGCUUCUGCAACCAAGCGGGUCUUACCCCCGGUCCUCCGCGUCUCCAGUCCUCGCACCUGGAACCCCAACGUCCCCGAGAGUCCCCGAAUCCCCGCUCCCAGGCUACCUAAGAGGAUGAGCGGUGCUCCGACGGCCGGGGCAGCCCUGAUGCUCUGCGCCGCCACCGCCGUGCUACUGAGCGCUCAGGGCGGACCCGUGCAGUCCAAGUCGCCGCGCUUUGCGUCCUGGGACGAGAUGAAUGUCCUGGCGCACGGACUCCUGCAGCUCGGCCAGGGGCUGCGCGAACACGCGGAGCGCACCCGCAGUCAGCUGAGCGCGCUGGAGCGGCGCCUGAGCGCGUGCGGGUCCGCCUGUCAGGGAACCGAGGGGUCCACCGACCUCCCGUUAGCCCCUGAGAGCCGGGUGGACCCUGAGGUCCUUCACAGCCUGCAGACACAACUCAAGGCUCAGAACAGCAGGAUCCAGCAACUCUUCCACAAGGUGGCCCAGCAGCAGCGGCACCUGGAGAAGCAGCACCUGCGAAUUCAGCAUCUGCAAAGCCAGUUUGGCCUCCUGGACCACAAGCACCUAGACCAUGAGGUGGCCAAGCCUGCCCGAAGAAAGAGGCUGCCCGAGAUGGCCCAGCCAGUUGACCCGGCUCACAAUGUCAGCCGCCUGCACCGGCUGCCCAGGGAUUGCCAGGAGCUGUUCCAGGUUGGGGAGAGGCAGAGUGGACUAUUUGAAAUCCAGCCUCAGGGGUCUCCGCCAUUUUUGGUGAACUGCAAGAUGACCUCAGAUGGAGGCUGGACAGUAAUUCAGAGGCGCCACGAUGGCUCAGUGGACUUCAACCGGCCCUGGGAAGCCUACAAGGCGGGGUUUGGGGAUCCCCACGGCGAGUUCUGGCUGGGUCUGGAGAAGGUGCAUAGCAUCACGGGGGACCGCAACAGCCGCCUGGCCGUGCAGCUGCGGGACUGGGAUGGCAACGCCGAGUUGCUGCAGUUCUCCGUGCACCUGGGUGGCGAGGACACGGCCUAUAGCCUGCAGCUCACUGCACCCGUGGCCGGCCAGCUGGGCGCCACCACCGUCCCACCCAGCGGCCUCUCCGUACCCUUCUCCACUUGGGACCAGGAUCACGACCUCCGCAGGGACAAGAACUGCGCCAAGAGCCUCUCUGGAGGCUGGUGGUUUGGCACCUGCAGCCAUUCCAACCUCAACGGCCAGUACUUCCGCUCCAUCCCACAGCAGCGGCAGAAGCUUAAGAAGGGAAUCUUCUGGAAGACCUGGCGGGGCCGCUACUACCCGCUGCAGGCCACCACCAUGUUGAUCCAGCCCAUGGCAGCAGAGGCAGCCUCCUAGCGUCCUGGCUGGGCCUGGUCCCAGGCCCACGAAAGACGGUGACUCUUGGCUCUGCCCGAGGAUGUGGCCGUUCCCUGCCUGGGCAGGGGCUCCAAGGAGGGGCCAUCUGGAAACUUGUGGACAGAGAAGAAGACCACGACUGGAGAAGCCCCCUUUCUGAGUGCAGGGGGGCUGCAUGCGUUGCCUCCUGAGAUCGAGGCUGCAGGAUAUGCUCAGACUCUAGAGGCGUGGACCAAGGGGCAUGGAGCUUCACUCCUUGCUGGCCAGGGAGUUGGGGACUCAGAGGGACCACUUGGGGCCAGCCAGACUGGCCUCAAUGGCGGACUCAGUCACAUUGACUGACGGGGACCAGGGCUUGUGUGGGUCGAGAGCGCCCUCAUGGUGCUGGUGCUGUUGUGUGUAGGUCCCCUGGGGACACAAGCAGGCGCCAAUGGUAUCUGGGCGGAGCUCACAGAGUUCUUGGAAUAAAAGCAACCUCAGAACA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 51129)
angiopoietin like 4
strand +
pp1158, PGAR, ARP4, HFARP, FIAF, NL2
NCBI CDS gene sequence (1221 bp)
5'-ATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTGCTACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGAACAGCAGGATCCAGCAACTCTTCCACAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACCTGCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAACCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCCTCCTAG-3'
NCBI CDS gene sequence with introns (location: 8364322.. 8373886) (9565 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 8364155.. 8374370) (10216 bp)Download
NCBI gene sequence (location: [8364155 - 1000].. 8374370) (11216 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905