Protein
Protein (NP_066969)
Angiopoietin-related protein 7
Angiopoietin-related protein 7 (Angiopoietin-like factor) (Angiopoietin-like protein 7) (Cornea-derived transcript 6 protein)
ANGPTL7
angiopoietin like 7
Undefined
Very low evidence
Ficolin-like
Undefined
a/b mixed with b-sheet / Fibrinogen C-ter like
Uncharacterised
0.594
Undefined
Protein sequence and protein families (fasta) (346 amino acids) Download
MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.33, 1.63] ÅDownload
The location of the lectin domain structural model is: 122-343
We infer [1.33, 1.63] Å as the interval of error of this structural model.
Template 1: 2JHK chain: F, O00602, NP_001994.2, sequence identity: 44.1%, coverage: 97.3%, location in sequence: 110-326, (81-297 in PDB).
Template 2: 2J3U chain: B, Q15485, NP_004099.2, sequence identity: 43.7%, coverage: 97.7%, location in sequence: 96-313, (71-288 in PDB).
Template 3: 6ZQX chain: A, Q8N539, NP_116232.3, sequence identity: 40.5%, coverage: 95.9%, location in sequence: 239-457, (239-457 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Cord Blood Levels of Angiopoietin-Like 7 (ANGPTL7) in Preterm Infants. [33313310]
  • Angptl7 promotes insulin resistance and type 2 diabetes mellitus by multiple mechanisms including SOCS3-mediated IRS1 degradation. [32786125]
  • Rare protein-altering variants in ANGPTL7 lower intraocular pressure and protect against glaucoma. [32369491]
  • Angiopoietin-like protein 7 mediates TNF-alpha-induced adhesion and oxidative stress in human umbilical vein epithelial cell. [32525822]
  • Angiopoietin-Like Protein 7 and Short-Term Mortality in Acute Heart Failure. [31962333]
  • The angiopoietin-like factor cornea-derived transcript 6 is a putative morphogen for human cornea. [11682471]
  • The human gene for mannan-binding lectin-associated serine protease-2 (MASP-2), the effector component of the lectin route of complement activation, is part of a tightly linked gene cluster on chromosome 1p36.2-3. [11426320]
  • Molecular cloning of a new angiopoietinlike factor from the human cornea. [9727400]
  • The thiol-specific antioxidant protein from human brain: gene cloning and analysis of conserved cysteine regions. [8144038]
  • Cloning and sequence analysis of candidate human natural killer-enhancing factor genes. [8026862]
UniProt Main References (9 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method. [21697133]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Signal peptide prediction based on analysis of experimentally verified cleavage sites. [15340161]
  • Gene expression profile of human trabecular meshwork cells in response to long-term dexamethasone exposure. [16541013]
  • Evidence for a role of angiopoietin-like 7 (ANGPTL7) in extracellular matrix formation of the human trabecular meshwork: implications for glaucoma. [21199193]
  • Angiopoietin-like 7 is an anti-angiogenic protein required to prevent vascularization of the cornea. [25622036]
All isoforms of this gene containing a lectin domain
NP_066969.1, XP_016855493.1
RNA
RNA (Transcript ID: NM_021146.4)
angiopoietin like 7
m7G-5')ppp(5'-GGGCUUGGAAGGAAAGCUAUAGGCUACCCAUUCAGCUCCCCUGUCAGAGACUCAAGCUUUGAGAAAGGCUAGCAAAGAGCAAGGAAAGAGAGAAAACAACAAAGUGGCGAGGCCCUCAGAGUGAAAGCGUAAGGUUCAGUCAGCCUGCUGCAGCUUUGCAGACCUCAGCUGGGCAUCUCCAGACUCCCCUGAAGGAAGAGCCUUCCUCACCCAAACCCACAAAAGAUGCUGAAAAAGCCUCUCUCAGCUGUGACCUGGCUCUGCAUUUUCAUCGUGGCCUUUGUCAGCCACCCAGCGUGGCUGCAGAAGCUCUCUAAGCACAAGACACCAGCACAGCCACAGCUCAAAGCGGCCAACUGCUGUGAGGAGGUGAAGGAGCUCAAGGCCCAAGUUGCCAACCUUAGCAGCCUGCUGAGUGAACUGAACAAGAAGCAGGAGAGGGACUGGGUCAGCGUGGUCAUGCAGGUGAUGGAGCUGGAGAGCAACAGCAAGCGCAUGGAGUCGCGGCUCACAGAUGCUGAGAGCAAGUACUCCGAGAUGAACAACCAAAUUGACAUCAUGCAGCUGCAGGCAGCACAGACGGUCACUCAGACCUCCGCAGAUGCCAUCUACGACUGCUCUUCCCUCUACCAGAAGAACUACCGCAUCUCUGGAGUGUAUAAGCUUCCUCCUGAUGACUUCCUGGGCAGCCCUGAACUGGAGGUGUUCUGUGACAUGGAGACUUCAGGCGGAGGCUGGACCAUCAUCCAGAGACGAAAAAGUGGCCUUGUCUCCUUCUACCGGGACUGGAAGCAGUACAAGCAGGGCUUUGGCAGCAUCCGUGGGGACUUCUGGCUGGGGAACGAACACAUCCACCGGCUCUCCAGACAGCCAACCCGGCUGCGUGUAGAGAUGGAGGACUGGGAGGGCAACCUGCGCUACGCUGAGUAUAGCCACUUUGUUUUGGGCAAUGAACUCAACAGCUAUCGCCUCUUCCUGGGGAACUACACUGGCAAUGUGGGGAACGACGCCCUCCAGUAUCAUAACAACACAGCCUUCAGCACCAAGGACAAGGACAAUGACAACUGCUUGGACAAGUGUGCACAGCUCCGCAAAGGUGGCUACUGGUACAACUGCUGCACAGACUCCAACCUCAAUGGAGUGUACUACCGCCUGGGUGAGCACAAUAAGCACCUGGAUGGCAUCACCUGGUAUGGCUGGCAUGGAUCUACCUACUCCCUCAAACGGGUGGAGAUGAAAAUCCGCCCAGAAGACUUCAAGCCUUAAAAGGAGGCUGCCGUGGAGCACGGAUACAGAAACUGAGACACGUGGAGACUGGAUGAGGGCAGAUGAGGACAGGAAGAGAGUGUUAGAAAGGGUAGGACUGAGAAACAGCCUAUAAUCUCCAAAGAAAGAAUAAGUCUCCAAGGAGCACAAAAAAAUCAUAUGUACCAAGGAUGUUACAGUAAACAGGAUGAACUAUUUAAACCCACUGGGUCCUGCCACAUCCUUCUCAAGGUGGUAGACUGAGUGGGGUCUCUCUGCCCAAGAUCCCUGACAUAGCAGUAGCUUGUCUUUUCCACAUGAUUUGUCUGUGAAAGAAAAUAAUUUUGAGAUCGUUUUAUCUAUUUUCUCUACGGCUUAGGCUAUGUGAGGGCAAAACACAAAUCCCUUUGCUAAAAAGAACCAUAUUAUUUUGAUUCUCAAAGGAUAGGCCUUUGAGUGUUAGAGAAAGGAGUGAAGGAGGCAGGUGGGAAAUGGUAUUUCUAUUUUUAAAUCCAGUGAAAUUAUCUUGAGUCUACACAUUAUUUUUAAAACACAAAAAUUGUUCGGCUGGAACUGACCCAGGCUGGACUUGCGGGGAGGAAACUCCAGGGCACUGCAUCUGGCGAUCAGACUCUGAGCACUGCCCCUGCUCGCCUUGGUCAUGUACAGCACUGAAAGGAAUGAAGCACCAGCAGGAGGUGGACAGAGUCUCUCAUGGAUGCCGGCACAAAACUGCCUUAAAAUAUUCAUAGUUAAUACAGGUAUAUCUAUUUUUAUUUACUUUGUAAGAAACAAGCUCAAGGAGCUUCCUUUUAAAUUUUGUCUGUAGGAAAUGGUUGAAAACUGAAGGUAGAUGGUGUUAUAGUUAAUAAUAAAUGCUGUAAAUAAGCAUCUCACUUUGUAAAAAUAAAAUAUUGUGGUUUUGUUUUAAACAUUCAACGUUUCUUUUCCUUCUACAAUAAACACUUUCAAAAUGUGA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 10218)
angiopoietin like 7
strand +
CDT6, AngX
NCBI CDS gene sequence (1041 bp)
5'-ATGCTGAAAAAGCCTCTCTCAGCTGTGACCTGGCTCTGCATTTTCATCGTGGCCTTTGTCAGCCACCCAGCGTGGCTGCAGAAGCTCTCTAAGCACAAGACACCAGCACAGCCACAGCTCAAAGCGGCCAACTGCTGTGAGGAGGTGAAGGAGCTCAAGGCCCAAGTTGCCAACCTTAGCAGCCTGCTGAGTGAACTGAACAAGAAGCAGGAGAGGGACTGGGTCAGCGTGGTCATGCAGGTGATGGAGCTGGAGAGCAACAGCAAGCGCATGGAGTCGCGGCTCACAGATGCTGAGAGCAAGTACTCCGAGATGAACAACCAAATTGACATCATGCAGCTGCAGGCAGCACAGACGGTCACTCAGACCTCCGCAGATGCCATCTACGACTGCTCTTCCCTCTACCAGAAGAACTACCGCATCTCTGGAGTGTATAAGCTTCCTCCTGATGACTTCCTGGGCAGCCCTGAACTGGAGGTGTTCTGTGACATGGAGACTTCAGGCGGAGGCTGGACCATCATCCAGAGACGAAAAAGTGGCCTTGTCTCCTTCTACCGGGACTGGAAGCAGTACAAGCAGGGCTTTGGCAGCATCCGTGGGGACTTCTGGCTGGGGAACGAACACATCCACCGGCTCTCCAGACAGCCAACCCGGCTGCGTGTAGAGATGGAGGACTGGGAGGGCAACCTGCGCTACGCTGAGTATAGCCACTTTGTTTTGGGCAATGAACTCAACAGCTATCGCCTCTTCCTGGGGAACTACACTGGCAATGTGGGGAACGACGCCCTCCAGTATCATAACAACACAGCCTTCAGCACCAAGGACAAGGACAATGACAACTGCTTGGACAAGTGTGCACAGCTCCGCAAAGGTGGCTACTGGTACAACTGCTGCACAGACTCCAACCTCAATGGAGTGTACTACCGCCTGGGTGAGCACAATAAGCACCTGGATGGCATCACCTGGTATGGCTGGCATGGATCTACCTACTCCCTCAAACGGGTGGAGATGAAAATCCGCCCAGAAGACTTCAAGCCTTAA-3'
NCBI CDS gene sequence with introns (location: 11189580.. 11195023) (5444 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 11189355.. 11195981) (6627 bp)Download
NCBI gene sequence (location: [11189355 - 1000].. 11195981) (7627 bp)Download
Cite How to cite