NCBI Summary
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_006673)
Fibroleukin
Fibroleukin (Fibrinogen-like protein 2) (pT49)
FGL2
fibrinogen like 2
Undefined
Very low evidence
Ficolin-like
Undefined
a/b mixed with b-sheet / Fibrinogen C-ter like
Uncharacterised
0.539
Undefined
Protein sequence and protein families (fasta) (439 amino acids) Download
MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.41, 1.76] ÅDownload
The location of the lectin domain structural model is: 204-436
We infer [1.41, 1.76] Å as the interval of error of this structural model.
Template 1: 6ZQX chain: A, Q8N539, NP_116232.3, sequence identity: 38.6%, coverage: 91.8%, location in sequence: 239-457, (239-457 in PDB).
Template 2: 2JHK chain: F, O00602, NP_001994.2, sequence identity: 37.8%, coverage: 93.1%, location in sequence: 110-326, (81-297 in PDB).
Template 3: 2J3U chain: B, Q15485, NP_004099.2, sequence identity: 37.3%, coverage: 93.1%, location in sequence: 96-313, (71-288 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Soluble fibrinogen-like protein 2 levels are decreased in patients with ischemic heart failure and associated with cardiac function. [34109427]
  • Identifying novel genetic variants for brain amyloid deposition: a genome-wide association study in the Korean population. [34154648]
  • Regulatory T cells induce polarization of pro-repair macrophages by secreting sFGL2 into the endometriotic milieu. [33893391]
  • Dabigatran activates inflammation resolution by promoting fibrinogen-like protein 2 shedding and RvD5n-3 DPA production. [33754059]
  • Tumor-associated macrophage polarization promotes the progression of esophageal carcinoma. [33323552]
  • Identification of a novel human angiopoietin-like gene expressed mainly in heart. [12624729]
  • Genomic characterization, localization, and functional expression of FGL2, the human gene encoding fibroleukin: a novel human procoagulant. [11170750]
  • Characterization of human fibroleukin, a fibrinogen-like protein secreted by T lymphocytes. [9647217]
  • Sequence of a human transcript expressed in T-lymphocytes and encoding a fibrinogen-like protein. [7642106]
  • Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin. [1602151]
UniProt Main References (3 PubMed Identifiers)
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. [16335952]
  • Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. [19159218]
RNA
RNA (Transcript ID: NM_006682.3)
fibrinogen like 2
m7G-5')ppp(5'-CUGCUGGGGUGAGCAGCACUGUAAAGAUGAAGCUGGCUAACUGGUACUGGCUGAGCUCAGCUGUUCUUGCCACUUACGGUUUUUUGGUUGUGGCAAACAAUGAAACAGAGGAAAUUAAAGAUGAAAGAGCAAAGGAUGUCUGCCCAGUGAGACUAGAAAGCAGAGGGAAAUGCGAAGAGGCAGGGGAGUGCCCCUACCAGGUAAGCCUGCCCCCCUUGACUAUUCAGCUCCCGAAGCAAUUCAGCAGGAUCGAGGAGGUGUUCAAAGAAGUCCAAAACCUCAAGGAAAUCGUAAAUAGUCUAAAGAAAUCUUGCCAAGACUGCAAGCUGCAGGCUGAUGACAACGGAGACCCAGGCAGAAACGGACUGUUGUUACCCAGUACAGGAGCCCCGGGAGAGGUUGGUGAUAACAGAGUUAGAGAAUUAGAGAGUGAGGUUAACAAGCUGUCCUCUGAGCUAAAGAAUGCCAAAGAGGAGAUCAAUGUACUUCAUGGUCGCCUGGAGAAGCUGAAUCUUGUAAAUAUGAACAACAUAGAAAAUUAUGUUGACAGCAAAGUGGCAAAUCUAACAUUUGUUGUCAAUAGUUUGGAUGGCAAAUGUUCAAAGUGUCCCAGCCAAGAACAAAUACAGUCACGUCCAGUUCAACAUCUAAUAUAUAAAGAUUGCUCUGACUACUACGCAAUAGGCAAAAGAAGCAGUGAGACCUACAGAGUUACACCUGAUCCCAAAAAUAGUAGCUUUGAAGUUUACUGUGACAUGGAGACCAUGGGGGGAGGCUGGACAGUGCUGCAGGCACGUCUCGAUGGGAGCACCAACUUCACCAGAACAUGGCAAGACUACAAAGCAGGCUUUGGAAACCUCAGAAGGGAAUUUUGGCUGGGGAACGAUAAAAUUCAUCUUCUGACCAAGAGUAAGGAAAUGAUUCUGAGAAUAGAUCUUGAAGACUUUAAUGGUGUCGAACUAUAUGCCUUGUAUGAUCAGUUUUAUGUGGCUAAUGAGUUUCUCAAAUAUCGUUUACACGUUGGUAACUAUAAUGGCACAGCUGGAGAUGCAUUACGUUUCAACAAACAUUACAACCACGAUCUGAAGUUUUUCACCACUCCAGAUAAAGACAAUGAUCGAUAUCCUUCUGGGAACUGUGGGCUGUACUACAGUUCAGGCUGGUGGUUUGAUGCAUGUCUUUCUGCAAACUUAAAUGGCAAAUAUUAUCACCAAAAAUACAGAGGUGUCCGUAAUGGGAUUUUCUGGGGUACCUGGCCUGGUGUAAGUGAGGCACACCCUGGUGGCUACAAGUCCUCCUUCAAAGAGGCUAAGAUGAUGAUCAGACCCAAGCACUUUAAGCCAUAAAUCACUCUGUUCAUUCCUCCAGGUAUUCGUUAUCUAAUAGGGCAAUUAAUUCCUUCAGCACUUUAGAAUAUGCCUUGUUUCAUAUUUUUCAUAGCUAAAAAAUGAUGUCUGACGGCUAGGUUCUUAUGCUACACAGCAUUUGAAAUAAAGCUGAAAAACAAUGCAUUUUAAAGGAGUCCUUUGUUGUUAUGCUGUUAUCCAAUGAACACUUGCAAGCAAUUAGCAAUAUUGAGAAUUAUACAUUAGAUUUACAAUUCUUUUAAUUUCUAUUGAAACUUUUUCUAUUGCUUGUAUUACUUGCUGUAUUUAAAAAAUAAUUGUUGGCUGGGUGUGGUAGCUCACGCCUGUAAUCCCAGCACUUUGGAAUGUCAAGGCAGGCAGAUCACUUGAGGUCAGGAGUUUGAGACCAGCCUGGCCAAACAUGUGAAACGCUGUCUCUAUUAAAAAUACAAAAAUUAGCCGGGCAUGGUGGUACAUGCCUGUAAUCCUAGCUACUUGGGAGGCUGAGGCAGGAGAAUCGCUUGAACCUGAGAGGAAGAGGUUGCAGUGAGCCAAGACUGAGCCACUGCACUCCAGCAUGGGUGACAGAGAAAACUCUGUCUCAAACAAAAAAAUAAUAAAAUUUAUUCAGUAGGCUGGAUUCUACACAAAGUAAUCUGUAUUUGGGCCAUGAUUUAAGCACAUCUGAAGGUAUAUCACUCUUUUCAGGCUAUAAUUAUUUGGGUAAUCUUCAUUCUGAGACAAACUUAAUCUAUAUCAUUUACUUUGCAACAGAACAACCCUACAGCAUUUUGGUUCCCAGACUAAGGGAACUAAUAUCUAUAUAAUUAAACUUGUUCAUUUAUCAUUCAUGAAAUAUAAAAUACUUGUCAUUUAAACCGUUUAAAAAUGUGGUAGCAUAAUGUCACCCCAAAAAGCAUUCAGAAAGCAAUGUAACUGUGAAGACCAGGGUUUAAAGGUAAUUCAUUUAUAGUUUAUAACUCCUUAGAUGUUUGAUGUUGAAAACUGCUUUAACAUGAAAAUUAUCUUCCUCUGCUCUGUGUGAACAAUAGCUUUUAAUUUAAGAUUGCUCACUACUGUACUAGACUACUGGUAGGUUUUUUUGGGGGGGGUGGGUAGGGAUAUGUGGGUAAUGAAGCAUUUACUUACAGGCUAUCAUACUCUGAGGCCAAUUUUAUCUCCAAAGCAAUAAUAUCAUUAAGUGAUUCACUUCAUAGAAGGCUAAGUUUCUCUAGGACAGAUAGAAAACAUGAAUUUUGAAAUAUAUAGAACAGUAGUUAAAAUACUAUAUAUUUCAACCCUGGCUGGUAGAUUGCUUAUUUUACUAUCAGAAACUAAAAGAUAGAUUUUUACCCAAACAGAAGUAUCUGUAAUUUUUAUAAUUCAUCAAUUCUGGAAUGCUAUAUAUAAUAUUUAAAAGACUUUUUAAAUGUGUUUAAUUUCAUCAUCGUAAAAAGGGAUCAUCUCAGAGAGAACAGCAGUAUUCUGCGUAUUUUUAAAAAUGCUCUAGAGUAACAUUUGAAGUAAUUCACUGUAGUGUAUGCCAGUCCUAGAAAUAAUUUUUUUAAUUUCUGGUGUCUGUUUCUAAUACACUAACCAAGUUUUCAAAAUAUAUUUACAAAGAUGCAUCUUUACCCAUUAUUUUAAAAUGAUUAAGGAGGAUAGUUGCUUCAGGUAACAAGCUAAUUUUUCAAAUAUUAGGCCCUUACAGAACUAUUUAGUCAAAAAGUAAGAUAUUCCUUUAAAAUAUAUAACCCAAAGCUUUCAGUUAAACAUGAUAUAUCACAAAUACUAUUAAAAUGUUAAAGAGAAAUGCAAAUAGCAUUAAAUGAUGACCAAAAUGUAAAAUAUUGUAGAUUUCAAAAGCUGUGUCUCUAUUAGGUGGGAUACCAAAUGUAAAUGAUGUAACUGACGUUGUUUUUUACUUUUUACUUUUUAAAAAAGACUAAAAACGUUUUGAUAUUAUACAAUGUAUUUGUUUCAGAUAAGGUCAUUGUCAUUUAGUAUAUAUAAUUAAUAUAUGUACAAGUUUAAGUAAAUUCCUGUGAGUAAAAAUGGACUUAUCACAAAACAUAGUUCUAAAGAAAGGUAUAUGCUCAUAUACACGGUGUCCAUUAAUUUAAUGGGAACUAGGUAUAACUUCAGGAGAAUUUGGCAAAUAAUUCAUUAAUCCAUGUAAAUAUUCAAAAGCUUGUUCUAUCCACAUUAUUUCAAGGGAUCACUUUAUUUUUCAUUAUACUUUCACAGCACUUUUCUAGUAAAUUCUGUAACACAGAAAUUCCAUUUUGGAAUCAUUUCAUGUUACCAAUAAUUCUAGACUUUUAUAACAUUUAACAUGUUGAUGGAAAUAGAUUACAUCUGCUAGAACCUUUUGCCUUAACUAUUCACCAAUAUAUGCUAAUAUUCAUAAAUAUGGAUUGACUGUUUACAAACAUUAGAAUCUUGUCUUGGUUCCAUUUUGAUGGCUAAUAUUUGUUAUCUUAAUUAAGACUAUUUCUGAGGUCAUGAUUACUUGAAAAUAUUGACUAAAACUGGGUCCUUAGAAAUUCCAGGUGGAGCUGAUUUACCUAUGACUGAGGGGAAAAAAAAAUCAAAUUUUACUGAUAAUAGUAAUGCUCCAAAUGAAUUAAUGACACAUCUGUUCAAUAAAUAAAGAGCUUAAAUAUACAAAACAUAAGAAAUCUGGGCAACAAAACUUGUGGUCUUUACUUUUGAAUAGCUACCCAAGAAAAGGUUUUAAAGGUAAAAGUUAUGAGUAAUGUCAUCACAAUAAGCUCUUGUUUAAAAUUCUUUUCUUUUAUGUAUAAUUAGGUUUAUGUUUCAUGUCUUUUUAAAACCUUAUAAAAGAUUUAAUUAUCACAUCUAUUCUUCAAUGUGGAAAUAUUAAAUAUUGUUGGUUGUAAAAUAAUA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 10875)
fibrinogen like 2
strand -
pT49, T49
NCBI CDS gene sequence (1320 bp)
5'-ATGAAGCTGGCTAACTGGTACTGGCTGAGCTCAGCTGTTCTTGCCACTTACGGTTTTTTGGTTGTGGCAAACAATGAAACAGAGGAAATTAAAGATGAAAGAGCAAAGGATGTCTGCCCAGTGAGACTAGAAAGCAGAGGGAAATGCGAAGAGGCAGGGGAGTGCCCCTACCAGGTAAGCCTGCCCCCCTTGACTATTCAGCTCCCGAAGCAATTCAGCAGGATCGAGGAGGTGTTCAAAGAAGTCCAAAACCTCAAGGAAATCGTAAATAGTCTAAAGAAATCTTGCCAAGACTGCAAGCTGCAGGCTGATGACAACGGAGACCCAGGCAGAAACGGACTGTTGTTACCCAGTACAGGAGCCCCGGGAGAGGTTGGTGATAACAGAGTTAGAGAATTAGAGAGTGAGGTTAACAAGCTGTCCTCTGAGCTAAAGAATGCCAAAGAGGAGATCAATGTACTTCATGGTCGCCTGGAGAAGCTGAATCTTGTAAATATGAACAACATAGAAAATTATGTTGACAGCAAAGTGGCAAATCTAACATTTGTTGTCAATAGTTTGGATGGCAAATGTTCAAAGTGTCCCAGCCAAGAACAAATACAGTCACGTCCAGTTCAACATCTAATATATAAAGATTGCTCTGACTACTACGCAATAGGCAAAAGAAGCAGTGAGACCTACAGAGTTACACCTGATCCCAAAAATAGTAGCTTTGAAGTTTACTGTGACATGGAGACCATGGGGGGAGGCTGGACAGTGCTGCAGGCACGTCTCGATGGGAGCACCAACTTCACCAGAACATGGCAAGACTACAAAGCAGGCTTTGGAAACCTCAGAAGGGAATTTTGGCTGGGGAACGATAAAATTCATCTTCTGACCAAGAGTAAGGAAATGATTCTGAGAATAGATCTTGAAGACTTTAATGGTGTCGAACTATATGCCTTGTATGATCAGTTTTATGTGGCTAATGAGTTTCTCAAATATCGTTTACACGTTGGTAACTATAATGGCACAGCTGGAGATGCATTACGTTTCAACAAACATTACAACCACGATCTGAAGTTTTTCACCACTCCAGATAAAGACAATGATCGATATCCTTCTGGGAACTGTGGGCTGTACTACAGTTCAGGCTGGTGGTTTGATGCATGTCTTTCTGCAAACTTAAATGGCAAATATTATCACCAAAAATACAGAGGTGTCCGTAATGGGATTTTCTGGGGTACCTGGCCTGGTGTAAGTGAGGCACACCCTGGTGGCTACAAGTCCTCCTTCAAAGAGGCTAAGATGATGATCAGACCCAAGCACTTTAAGCCATAA-3'
NCBI CDS gene sequence with introns (location: 77196279.. 77199793) (3515 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 77193369.. 77199819) (6451 bp)Download
NCBI gene sequence (location: [77193369.. 77199819 + 1000]) (7451 bp)Download
Cite How to cite