NCBI Summary
Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_004664)
Angiopoietin-related protein 1
Angiopoietin-related protein 1 (Angiopoietin-3) (ANG-3) (Angiopoietin-like protein 1)
ANGPTL1
angiopoietin like 1
Undefined
Very low evidence
Ficolin-like
Undefined
a/b mixed with b-sheet / Fibrinogen C-ter like
Uncharacterised
0.567
Undefined
Protein sequence and protein families (fasta) (491 amino acids) Download
MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.35, 1.67] ÅDownload
The location of the lectin domain structural model is: 271-491
We infer [1.35, 1.67] Å as the interval of error of this structural model.
Template 1: 6ZQX chain: A, Q8N539, NP_116232.3, sequence identity: 42.5%, coverage: 96.8%, location in sequence: 239-457, (239-457 in PDB).
Template 2: 2J5Z chain: A, O75636, NP_003656.2, sequence identity: 40.3%, coverage: 96.4%, location in sequence: 86-299, (63-276 in PDB).
Template 3: 2J3U chain: B, Q15485, NP_004099.2, sequence identity: 39.8%, coverage: 98.2%, location in sequence: 96-313, (71-288 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Respiratory traits and coal workers' pneumoconiosis: Mendelian randomisation and association analysis. [33097673]
  • Exosomal ANGPTL1 attenuates colorectal cancer liver metastasis by regulating Kupffer cell secretion pattern and impeding MMP9 induced vascular leakiness. [33413536]
  • Long non-coding RNA ANGPTL1-3 promotes multiple myeloma bortezomib resistance by sponging miR-30a-3p to activate c-Maf expression. [31103265]
  • ANGPTL1 Interacts with Integrin alpha1beta1 to Suppress HCC Angiogenesis and Metastasis by Inhibiting JAK2/STAT3 Signaling. [28904065]
  • ANGPTL1 attenuates colorectal cancer metastasis by up-regulating microRNA-138. [28606130]
  • Molecular cloning, expression, and characterization of angiopoietin-related protein. angiopoietin-related protein induces endothelial cell sprouting. [10473614]
  • Heterodimeric interactions between chicken ovalbumin upstream promoter-transcription factor family members ARP1 and ear2. [10318855]
  • Angiopoietins 3 and 4: diverging gene counterparts in mice and humans. [10051567]
  • Molecular cloning and characterization of a novel angiopoietin family protein, angiopoietin-3. [10025962]
  • Construction of a 1.2-Mb sequence-ready contig of chromosome 11q13 encompassing the multiple endocrine neoplasia type 1 (MEN1) gene. The European Consortium on MEN1. [9286704]
UniProt Main References (4 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. [16303743]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
All isoforms of this gene containing a lectin domain
NP_001363692.1, NP_004664.1
RNA
RNA (Transcript ID: NM_004673.4)
angiopoietin like 1, transcript variant 1
m7G-5')ppp(5'-ACUGUAUAUACAAUCUGGGUCAGCUGCAGCUGGUUACUGCAUUUCUCCAUGUGGCAGACAGAGCAAAGCCACAACGCUUUCUCUGCUGGAUUAAAGACGGCCCACAGACCAGAACUUCCACUAUACUACUUAAAAUUACAUAGGUGGCUUGUCAAAUUCAAUUGAUUAGUAUUGUAAAAGGAAAAAGAAGUUCCUUCUUACAGCUUGGAUUCAACGGUCCAAAACAAAAAUGCAGCUGCCAUUAAAGUCACAGAUGAACAAACUUCUACACUGAUUUUUAAAAUCAAGAAUAAGGGCAGCAAGUUUCUGGAUUCACUGAAUCAACAGACACAAAAAGCUGGCAAUAUAGCAACUAUGAAGAGAAAAGCUACUAAUAAAAUUAACCCAACGCAUAGAAGACUUUUUUUUCUCUUCUAAAAACAACUAAGUAAAGACUUAAAUUUAAACACAUCAUUUUACAACCUCAUUUCAAAAUGAAGACUUUUACCUGGACCCUAGGUGUGCUAUUCUUCCUACUAGUGGACACUGGACAUUGCAGAGGUGGACAAUUCAAAAUUAAAAAAAUAAACCAGAGAAGAUACCCUCGUGCCACAGAUGGUAAAGAGGAAGCAAAGAAAUGUGCAUACACAUUCCUGGUACCUGAACAAAGAAUAACAGGGCCAAUCUGUGUCAACACCAAGGGGCAAGAUGCAAGUACCAUUAAAGACAUGAUCACCAGGAUGGACCUUGAAAACCUGAAGGAUGUGCUCUCCAGGCAGAAGCGGGAGAUAGAUGUUCUGCAACUGGUGGUGGAUGUAGAUGGAAACAUUGUGAAUGAGGUAAAGCUGCUGAGAAAGGAAAGCCGUAACAUGAACUCUCGUGUUACUCAACUCUAUAUGCAAUUAUUACAUGAGAUUAUCCGUAAGAGGGAUAAUUCACUUGAACUUUCCCAACUGGAAAACAAAAUCCUCAAUGUCACCACAGAAAUGUUGAAGAUGGCAACAAGAUACAGGGAACUAGAGGUGAAAUACGCUUCCUUGACUGAUCUUGUCAAUAACCAAUCUGUGAUGAUCACUUUGUUGGAAGAACAGUGCUUGAGGAUAUUUUCCCGACAAGACACCCAUGUGUCUCCCCCACUUGUCCAGGUGGUGCCACAACAUAUUCCUAACAGCCAACAGUAUACUCCUGGUCUGCUGGGAGGUAACGAGAUUCAGAGGGAUCCAGGUUAUCCCAGAGAUUUAAUGCCACCACCUGAUCUGGCAACUUCUCCCACCAAAAGCCCUUUCAAGAUACCACCGGUAACUUUCAUCAAUGAAGGACCAUUCAAAGACUGUCAGCAAGCAAAAGAAGCUGGGCAUUCGGUCAGUGGGAUUUAUAUGAUUAAACCUGAAAACAGCAAUGGACCAAUGCAGUUAUGGUGUGAAAACAGUUUGGACCCUGGGGGUUGGACUGUUAUUCAGAAAAGAACAGACGGCUCUGUCAACUUCUUCAGAAAUUGGGAAAAUUAUAAGAAAGGGUUUGGAAACAUUGACGGAGAAUACUGGCUUGGACUGGAAAAUAUCUAUAUGCUUAGCAAUCAAGAUAAUUACAAGUUAUUGAUUGAAUUAGAAGACUGGAGUGAUAAAAAAGUCUAUGCAGAAUACAGCAGCUUUCGUCUGGAACCUGAAAGUGAAUUCUAUAGACUGCGCCUGGGAACUUACCAGGGAAAUGCAGGGGAUUCUAUGAUGUGGCAUAAUGGUAAACAAUUCACCACACUGGACAGAGAUAAAGAUAUGUAUGCAGGAAACUGCGCCCACUUUCAUAAAGGAGGCUGGUGGUACAAUGCCUGUGCACAUUCUAACCUAAAUGGAGUAUGGUACAGAGGAGGCCAUUACAGAAGCAAGCACCAAGAUGGAAUUUUCUGGGCCGAAUACAGAGGCGGGUCAUACUCCUUAAGAGCAGUUCAGAUGAUGAUCAAGCCUAUUGACUGAAGAGAGACACUCGCCAAUUUAAAUGACACAGAACUUUGUACUUUUCAGCUCUUAAAAAUGUAAAUGUUACAUGUAUAUUACUUGGCACAAUUUAUUUCUACACAGAAAGUUUUUAAAAUGAAUUUUACCGUAACUAUAAAAGGGAACCUAUAAAUGUAGUUUCAUCUGUCGUCAAUUACUGCAGAAAAUUAUGUGUAUCCACAACCUAGUUAUUUUAAAAAUUAUGUUGACUAAAUACAAAGUUUGUUUUCUAAAAUGUAAAUAUUUGCCACAAUGUAAAGCAAAUCUUAGCUAUAUUUUAAAUCAUAAAUAACAUGUUCAAGAUACUUAACAAUUUAUUUAAAAUCUAAGAUUGCUCUAACGUCUAGUGAAAAAAAUAUUUUUAAAAUUUCAGCCAAAUAAUGCAUUUUAUUUAUAAAAAUACAGACAGAAAAUUAGGGAGAAACCUCUAGUUUUGCCAAUAGAAAAUGCUUCUUCCAUUGAAUAAAAGUUAUUUCAAAUUGAAUUUGUGCCUUUCACACGUAAUGAUUAAAUCUGAAUUCUUAAUAAUAUAUCCUAUGCUGAUUUUCCCAAAACAUGACCCAUAGUAUUAAAUACAUAUCAUUUUUAAAAAUAAAAAAAAACCCAAAAAUAAUGCAUGCAUAAUUUAAAUGGUCAAUUUAUAAAGACAAAUCUAUGAAUGAAUUUUUCAGUGUUAUCUUCAUAUGAUAUGCUGAACACCAAAAUCUCCAGAAAUGCAUUUUAUGUAGUUCUAAAAUCAGCAAAAUAUUGGUAUUACAAAAAUGCAGAAUAUUUAGUGUGCUACAGAUCUGAAUUAUAGUUCUAAUUUAUUAUUACUUUUUUUCUAAUUUACUGAUCUUACUACUACAAAGAAAAAAAAACCCAACCAAUCUGCAAUUCAAAUCAGAAAGUUUGGACAGCUUUACAAGUAUUAGUGCAUGCUCAGAACAGGUGGGACUAAAACAAACUCAAGGAACUGUUGGCUGUUUUCCCGAUACUGAGAAUUCAACAGCUCCAGAGCAGAAGCCACAGGGGCAUAGCUUAGUCCAAACUGCUAAUUUCAUUUUACAGUGUAUGUAACGCUUAGUCUCACAGUGUCUUUAACUCAUCUUUGCAAUCAACAACUUUACUAGUGACUUUCUGGAACAAUUUCCUUUCAGGAAUACAUAUUCACUGCUUAGAGGUGACCUUGCCUUAAUAUAUUUGUGAAGUUAAAAUUUUAAAGAUAGCUCAUGAAACUUUUGCUUAAGCAAAAAGAAAACCUCGAAUUGAAAUGUGUGAGGCAAACUAUGCAUGGGAAUAGCUUAAUGUGAAGAUAAUCAUUUGGACAACUCAAAUCCAUCAACAUGACCAAUGUUUUUCAUCUGCCACAUCUCAAAAUAAAACUUCUGGUGAAACAAAUUAAACAAAAUAUCCAAACCUCAUAGUGGUAUUAUUCUUUGUUUUACCUGUGGUCAUCUUAAACUGGUUUUUCAGUCCCUCUCCACUUCCUUCAGAACCAAAGAAUCUGUUAUAAGAUUCCUGGAAGGAACUGGGCAUCUAACUGUUACACCAAAUCUUAAGUGAAUAAAACUUUACCAAGGCUUCUCAGUUA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 9068)
angiopoietin like 1
strand -
ANG3, AngY, ARP1
489
NCBI CDS gene sequence (1476 bp)
5'-ATGAAGACTTTTACCTGGACCCTAGGTGTGCTATTCTTCCTACTAGTGGACACTGGACATTGCAGAGGTGGACAATTCAAAATTAAAAAAATAAACCAGAGAAGATACCCTCGTGCCACAGATGGTAAAGAGGAAGCAAAGAAATGTGCATACACATTCCTGGTACCTGAACAAAGAATAACAGGGCCAATCTGTGTCAACACCAAGGGGCAAGATGCAAGTACCATTAAAGACATGATCACCAGGATGGACCTTGAAAACCTGAAGGATGTGCTCTCCAGGCAGAAGCGGGAGATAGATGTTCTGCAACTGGTGGTGGATGTAGATGGAAACATTGTGAATGAGGTAAAGCTGCTGAGAAAGGAAAGCCGTAACATGAACTCTCGTGTTACTCAACTCTATATGCAATTATTACATGAGATTATCCGTAAGAGGGATAATTCACTTGAACTTTCCCAACTGGAAAACAAAATCCTCAATGTCACCACAGAAATGTTGAAGATGGCAACAAGATACAGGGAACTAGAGGTGAAATACGCTTCCTTGACTGATCTTGTCAATAACCAATCTGTGATGATCACTTTGTTGGAAGAACAGTGCTTGAGGATATTTTCCCGACAAGACACCCATGTGTCTCCCCCACTTGTCCAGGTGGTGCCACAACATATTCCTAACAGCCAACAGTATACTCCTGGTCTGCTGGGAGGTAACGAGATTCAGAGGGATCCAGGTTATCCCAGAGATTTAATGCCACCACCTGATCTGGCAACTTCTCCCACCAAAAGCCCTTTCAAGATACCACCGGTAACTTTCATCAATGAAGGACCATTCAAAGACTGTCAGCAAGCAAAAGAAGCTGGGCATTCGGTCAGTGGGATTTATATGATTAAACCTGAAAACAGCAATGGACCAATGCAGTTATGGTGTGAAAACAGTTTGGACCCTGGGGGTTGGACTGTTATTCAGAAAAGAACAGACGGCTCTGTCAACTTCTTCAGAAATTGGGAAAATTATAAGAAAGGGTTTGGAAACATTGACGGAGAATACTGGCTTGGACTGGAAAATATCTATATGCTTAGCAATCAAGATAATTACAAGTTATTGATTGAATTAGAAGACTGGAGTGATAAAAAAGTCTATGCAGAATACAGCAGCTTTCGTCTGGAACCTGAAAGTGAATTCTATAGACTGCGCCTGGGAACTTACCAGGGAAATGCAGGGGATTCTATGATGTGGCATAATGGTAAACAATTCACCACACTGGACAGAGATAAAGATATGTATGCAGGAAACTGCGCCCACTTTCATAAAGGAGGCTGGTGGTACAATGCCTGTGCACATTCTAACCTAAATGGAGTATGGTACAGAGGAGGCCATTACAGAAGCAAGCACCAAGATGGAATTTTCTGGGCCGAATACAGAGGCGGGTCATACTCCTTAAGAGCAGTTCAGATGATGATCAAGCCTATTGACTGA-3'
NCBI CDS gene sequence with introns (location: 178851129.. 178865776) (14648 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 178849535.. 178871077) (21543 bp)Download
NCBI gene sequence (location: [178849535.. 178871077 + 1000]) (22543 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905