NCBI Summary
This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010].
Protein
Protein (NP_002395)
Microfibril-associated glycoprotein 4
Microfibril-associated glycoprotein 4
MFAP4
microfibril associated protein 4
Undefined
Very low evidence
Ficolin-like
Undefined
a/b mixed with b-sheet / Fibrinogen C-ter like
MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
No structure currently available in the PDB RCSB Databank.
Structural models
SWISS-MODEL structural models
The location of the lectin domain structural model is: 32-255
We infer [1.17, 1.42] Å as the interval of error of this structural model.
Template 1: 6ZQX chain: A, Q8N539, NP_116232.3, sequence identity: 54.0%, coverage: 97.8%, location in sequence: 239-457, (239-457 in PDB).
Template 2: 2J3U chain: B, Q15485, NP_004099.2, sequence identity: 48.7%, coverage: 97.3%, location in sequence: 96-313, (71-288 in PDB).
Template 3: 2JHK chain: F, O00602, NP_001994.2, sequence identity: 47.8%, coverage: 96.9%, location in sequence: 110-326, (81-297 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
We infer [1.17, 1.42] Å as the interval of error of this structural model.
Template 1: 6ZQX chain: A, Q8N539, NP_116232.3, sequence identity: 54.0%, coverage: 97.8%, location in sequence: 239-457, (239-457 in PDB).
Template 2: 2J3U chain: B, Q15485, NP_004099.2, sequence identity: 48.7%, coverage: 97.3%, location in sequence: 96-313, (71-288 in PDB).
Template 3: 2JHK chain: F, O00602, NP_001994.2, sequence identity: 47.8%, coverage: 96.9%, location in sequence: 110-326, (81-297 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
- Microfibril associated protein 4 (MFAP4) is a carrier of the tumor associated carbohydrate sialyl-Lewis x (sLex) in pancreatic adenocarcinoma. [33038510]
- Human Microfibrillar-Associated Protein 4 (MFAP4) Gene Promoter: A TATA-Less Promoter That Is Regulated by Retinol and Coenzyme Q10 in Human Fibroblast Cells. [33182307]
- The fibrinogen C-terminal domain is seldom C-mannosylated but its C-mannosylation is important for the secretion of microfibril-associated glycoprotein 4. [32442478]
- High plasma microfibrillar-associated protein 4 is associated with reduced surgical repair in abdominal aortic aneurysms. [31784280]
- Relationship between Microfibrillar-Associated Protein 4 Levels and Subclinical Myocardial Damage in Chronic Kidney Disease. [32268335]
- Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. [16335952]
- Signal peptide prediction based on analysis of experimentally verified cleavage sites. [15340161]
- Microfibril-associated protein 4 is present in lung washings and binds to the collagen region of lung surfactant protein D. [10542261]
- Ultrastructural distribution of 36-kD microfibril-associated glycoprotein (MAGP-36) in human and bovine tissues. [10424889]
- The gene for a human microfibril-associated glycoprotein is commonly deleted in Smith-Magenis syndrome patients. [7633408]
UniProt Main References (5 PubMed Identifiers)
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. [16625196]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. [19159218]
- Characterization of Microfibrillar-associated Protein 4 (MFAP4) as a Tropoelastin- and Fibrillin-binding Protein Involved in Elastic Fiber Formation. [26601954]
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_002404.3)
microfibril associated protein 4, transcript variant 2
m7G-5')ppp(5'-GCAGACACCCAGCCACUCUGAGCAGAACUGACAGCAUGAAGGCACUCCUGGCCCUGCCGCUGCUGCUGCUUCUCUCCACGCCCCCGUGUGCCCCCCAGGUCUCCGGGAUCCGAGGAGAUGCUCUGGAGAGGUUUUGCCUUCAGCAACCCCUGGACUGUGACGACAUCUAUGCCCAGGGCUACCAGUCAGACGGCGUGUACCUCAUCUACCCCUCGGGCCCCAGUGUGCCUGUGCCCGUCUUCUGUGACAUGACCACCGAGGGCGGGAAGUGGACGGUUUUCCAGAAGAGAUUCAAUGGCUCAGUAAGUUUCUUCCGCGGCUGGAAUGACUACAAGCUGGGCUUCGGCCGUGCUGAUGGAGAGUACUGGCUGGGGCUGCAGAACAUGCACCUCCUGACACUGAAGCAGAAGUAUGAGCUGCGAGUGGACUUGGAGGACUUUGAGAACAACACGGCCUAUGCCAAGUACGCUGACUUCUCCAUCUCCCCGAACGCGGUCAGCGCAGAGGAGGAUGGCUACACCCUCUUUGUGGCAGGCUUUGAGGAUGGCGGGGCAGGUGACUCCCUGUCCUACCACAGUGGCCAGAAGUUCUCUACCUUCGACCGGGACCAGGACCUCUUUGUGCAGAACUGCGCAGCUCUCUCCUCAGGAGCCUUCUGGUUCCGCAGCUGCCACUUUGCCAACCUCAAUGGCUUCUACCUAGGUGGCUCCCACCUCUCUUAUGCCAAUGGCAUCAACUGGGCCCAGUGGAAGGGCUUCUACUACUCCCUCAAACGCACUGAGAUGAAAAUCCGCCGGGCCUGAAGGGCUGGCCCCCUCAGGCACCUUUCCUCCCCUGGACACCCAUGGUCUCCAUGAGUGCUCCCUCUGCUGCCCCUGAUGCAUGCUUCUGCUGAUUCCCGAGCACCAACUCCUUACAAGGGGGCCUUGUGGCUCUCAGCCAUGCCACAUCCCUGUCACACACCCAGGGCAUCCAUUCCUAAGCCAGACCCGGCUCCCCUACACCUGAAGUUACACUGCCAGCAGUUCCCCAGGCCUCUUCCGAGAGGCACAUGGUUCUAGCCUGGACCUGGCUGGGCUCCAUGAGAAUGAGUUGCCUCCAACCUGUCCCAACAGCUGACAGCCAGGAGCCACUCUCCCAGCUGCAGGCCUUUGUGGUCCAUCUUGUCCUGCUUCCUCACUGUGGACCCCUGUCUGGGCCACCCUAGUGUGCUAAGCUGAGCAGUGCAGUGUGAACAGGGCCCAUGGUGUAUUCUAGGCCACAGCCCAGCACUCCUCUGGGCUGCUCUCAAACCAUGUCCCAUCUUCAGCAUCCCUCCCACCAACUUACUCCCCUGUGGUGAGUACCGUGGAACCCCAGCCCACCUCACUAUCAUACUCAGCUUCCCCUGAUGGCCCAUCCCAGCCCCUGAAGCUCUAUGCCAAGAACACAGCUACCGCACACCACCCUGAAACAGCCACAGCCAAGGUAGGCAUGCAUAUGAGGUCUUCCCCAUACCCUCUGGGUGUUGAGAGGUUUAGCCACAUGAGGGAGCAGAGGACAAUCUCUGCAGGGCUGGGAGUGGGUAGGGACUGAAGGUCUCAAUAAACCUUCAGAACCUGAAUGAACUGGCUUCAUACACACAAACAUAUUUGUUUAUCCCCCAAAUGUAGGCACCUGGCUCCUCCUUGCUCCCCUGCUGAUGGUGUCCUACCCCGAACUCCAAAAAUUACACCUGGAGUCAGGUGCAGAAGGGAACCUUGUAUUUCACAGGCCUCAUUUUGAUGGCAAAAAGACAGUGUAAUAAUAACAUAAUAAUAAUAAAAAUAUAAUACUGAAAA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 4239)
microfibril associated protein 4
strand -
NCBI CDS gene sequence (768 bp)
5'-ATGAAGGCACTCCTGGCCCTGCCGCTGCTGCTGCTTCTCTCCACGCCCCCGTGTGCCCCCCAGGTCTCCGGGATCCGAGGAGATGCTCTGGAGAGGTTTTGCCTTCAGCAACCCCTGGACTGTGACGACATCTATGCCCAGGGCTACCAGTCAGACGGCGTGTACCTCATCTACCCCTCGGGCCCCAGTGTGCCTGTGCCCGTCTTCTGTGACATGACCACCGAGGGCGGGAAGTGGACGGTTTTCCAGAAGAGATTCAATGGCTCAGTAAGTTTCTTCCGCGGCTGGAATGACTACAAGCTGGGCTTCGGCCGTGCTGATGGAGAGTACTGGCTGGGGCTGCAGAACATGCACCTCCTGACACTGAAGCAGAAGTATGAGCTGCGAGTGGACTTGGAGGACTTTGAGAACAACACGGCCTATGCCAAGTACGCTGACTTCTCCATCTCCCCGAACGCGGTCAGCGCAGAGGAGGATGGCTACACCCTCTTTGTGGCAGGCTTTGAGGATGGCGGGGCAGGTGACTCCCTGTCCTACCACAGTGGCCAGAAGTTCTCTACCTTCGACCGGGACCAGGACCTCTTTGTGCAGAACTGCGCAGCTCTCTCCTCAGGAGCCTTCTGGTTCCGCAGCTGCCACTTTGCCAACCTCAATGGCTTCTACCTAGGTGGCTCCCACCTCTCTTATGCCAATGGCATCAACTGGGCCCAGTGGAAGGGCTTCTACTACTCCCTCAAACGCACTGAGATGAAAATCCGCCGGGCCTGA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.