NCBI Summary
This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jun 2020].
Protein
Protein (NP_000233)
MBP-C - mannose-binding protein C
Mannose-binding protein C (MBP-C) (Collectin-1) (MBP1) (Mannan-binding protein) (Mannose-binding lectin)
MBL2
mannose binding lectin 2
Undefined
Curated
C-type lectin
COLEC1
C-type - Collectins
a/b mixed / C-type lectin-like
Man, Fuc / Oligomannose and Lewis oligosaccharides
Undefined
0.403
Protein sequence and protein families (fasta) (248 amino acids) Download
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Impact of MBL-2 coding region polymorphism on modulation of HAND and HIV-1 acquisition. [34480982]
  • Mannose binding lectin gene 2 (rs1800450) missense variant may contribute to development and severity of COVID-19 infection. [33515713]
  • Genetic Association With Pseudomonas aeruginosa Acquisition in Cystic Fibrosis: Influence of Surfactant Protein D and Mannose-Binding Lectin. [33679736]
  • Deficiency of mannose-binding lectin is a risk of Pneumocystis jirovecii pneumonia in a natural history cohort of people living with HIV/AIDS in Northern Thailand. [33362211]
  • Association Study of MBL2 Gene Polymorphisms and Risk of Tuberculosis in Southeast of Iran. [33270011]
  • Gene frequency and partial protein characterization of an allelic variant of mannan binding protein associated with low serum concentrations. [1458688]
  • High frequencies in African and non-African populations of independent mutations in the mannose binding protein gene. [1304173]
  • Distinct and overlapping functions of allelic forms of human mannose binding protein. [1303250]
  • Molecular basis of opsonic defect in immunodeficient children. [1675710]
  • The gene for mannose-binding protein maps to chromosome 10 and is a marker for multiple endocrine neoplasia type 2. [1672848]
UniProt Main References (19 PubMed Identifiers)
  • A human mannose-binding protein is an acute-phase reactant that shares sequence homology with other vertebrate lectins. [2450948]
  • The human mannose-binding protein gene. Exon structure reveals its evolutionary relationship to a human pulmonary surfactant gene and localization to chromosome 10. [2477486]
  • Structure and evolutionary origin of the gene encoding a human serum mannose-binding protein. [2590164]
  • Different molecular events result in low protein levels of mannan-binding lectin in populations from southeast Africa and South America. [9743385]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Restricted polymorphisms of the mannose-binding lectin gene in a population of Papua New Guinea. [12175909]
  • Structure and function of mannan-binding proteins isolated from human liver and serum. [7982896]
  • A second serine protease associated with mannan-binding lectin that activates complement. [9087411]
  • Mannose-binding lectin engagement with late apoptotic and necrotic cells. [14515269]
  • Nucleic acid is a novel ligand for innate, immune pattern recognition collectins surfactant proteins A and D and mannose-binding lectin. [15145932]
  • Show more
All isoforms of this gene containing a lectin domain
NP_000233.1, NP_001365302.1, NP_001365303.1
RNA
RNA (Transcript ID: NM_000242.3)
mannose binding lectin 2, transcript variant 1
m7G-5')ppp(5'-ACACCAAGGUGAGGACCAUGUCCCUGUUUCCAUCACUCCCUCUCCUUCUCCUGAGUAUGGUGGCAGCGUCUUACUCAGAAACUGUGACCUGUGAGGAUGCCCAAAAGACCUGCCCUGCAGUGAUUGCCUGUAGCUCUCCAGGCAUCAACGGCUUCCCAGGCAAAGAUGGGCGUGAUGGCACCAAGGGAGAAAAGGGGGAACCAGGCCAAGGGCUCAGAGGCUUACAGGGCCCCCCUGGAAAGUUGGGGCCUCCAGGAAAUCCAGGGCCUUCUGGGUCACCAGGACCAAAGGGCCAAAAAGGAGACCCUGGAAAAAGUCCGGAUGGUGAUAGUAGCCUGGCUGCCUCAGAAAGAAAAGCUCUGCAAACAGAAAUGGCACGUAUCAAAAAGUGGCUCACCUUCUCUCUGGGCAAACAAGUUGGGAACAAGUUCUUCCUGACCAAUGGUGAAAUAAUGACCUUUGAAAAAGUGAAGGCCUUGUGUGUCAAGUUCCAGGCCUCUGUGGCCACCCCCAGGAAUGCUGCAGAGAAUGGAGCCAUUCAGAAUCUCAUCAAGGAGGAAGCCUUCCUGGGCAUCACUGAUGAGAAGACAGAAGGGCAGUUUGUGGAUCUGACAGGAAAUAGACUGACCUACACAAACUGGAACGAGGGUGAACCCAACAAUGCUGGUUCUGAUGAAGAUUGUGUAUUGCUACUGAAAAAUGGCCAGUGGAAUGACGUCCCCUGCUCCACCUCCCAUCUGGCCGUCUGUGAGUUCCCUAUCUGAAGGGUCAUAUCACUCAGGCCCUCCUUGUCUUUUUACUGCAACCCACAGGCCCACAGUAUGCUUGAAAAGAUAAAUUAUAUCAAUUUCCUCAUAUCCAGUAUUGUUCCUUUUGUGGGCAAUCACUAAAAAUGAUCACUAACAGCACCAACAAAGCAAUAAUAGUAGUAGUAGUAGUUAGCAGCAGCAGUAGUAGUCAUGCUAAUUAUAUAAUAUUUUUAAUAUAUACUAUGAGGCCCUAUCUUUUGCAUCCUACAUUAAUUAUCUAGUUUAAUUAAUCUGUAAUGCUUUCGAUAGUGUUAACUUGCUGCAGUAUGAAAAUAAGACGGAUUUAUUUUUCCAUUUACAACAAACACCUGUGCUCUGUUGAGCCUUCCUUUCUGUUUGGGUAGAGGGCUCCCCUAAUGACAUCACCACAGUUUAAUACCACAGCUUUUUACCAAGUUUCAGGUAUUAAGAAAAUCUAUUUUGUAACUUUCUCUAUGAACUCUGUUUUCUUUCUAAUGAGAUAUUAAACCAUGUAAAGAACAUAAAUAACAAAUCUCAAGCAAACAGCUUCACAAAUUCUCACACACAUACAUACCUAUAUACUCACUUUCUAGAUUAAGAUAUGGGACAUUUUUGACUCCCUAGAAGCCCCGUUAUAACUCCUCCUAGUACUAACUCCUAGGAAAAUACUAUUCUGACCUCCAUGACUGCACAGUAAUUUCGUCUGUUUAUAAACAUUGUAUAGUUGGAAUCAUAUUGUGUGUAAUGUUGUAUGUCUUGUUUACUCAGAAUUAAGUCUGUGAGAUUCAUUCAUGUCAUGUGUACAAAAGUUUCAUCCUUUUCAUUGCCAUGUAGGGUUCCCUUAUAUUAAUAUUCCUCAGUUCAUCCAUUCUAUUGUUAAUAGGCACUUAAGUGGCUUCCAAUUUUUGGCCAUGAGGAAGAGAACCCACGAACAUUCCUGGACUUGUCUUUUGGUGGACAUGGUGCACUAAUUUCACUACCUAUCCAGGAGUGGAACUGGUAGAGGAUGAGGAAAGCAUGUAUUCAGCUUUAGUAGAUAUUACCAGUUUUCCUAAGUGAUUGUAUGAAUUUAUGCUCCUACCGGCAAUGUGUGGCAGUCCUAGAUGCUCUAUGUGCUUGUAAAAAGUCAAUGUUUUCAGUUCUCUUGAUUUUCAUUAUUCCUGUGGAUGUAAAGUGAUAUUUCCCCAUGGUUUUAAUCUGUAUUUCCCCAACAUGUAAUAAGGUUGAACACUUUUUUAUAUGCUUAUUGGGCACUUGGGUAUCUUCUUUUGUGAAGUACCCGUUCACAUUUUUGUAUUUUGUUUAAAUUAGUUAGCCAAUAUUUUUCUUACUGAUUUUUAAGUUAUUUUUACAUUCUGAAUAUGUCCUUUUUAAUGUGUAUUACAAAUAUUUUGCUAGUUUUUGACUUGCUCCUAAUGUUGAAUUUUGAUGAACAAAAUUUCCUAAUUUUGAGAAAGUCUUAUUUAUUCAUAUUUUCUUUCAAAAUUAGUGCUUUUUGUGUCAUGUUUAAGAAAUUUUUGCCCAUCCCAAAAUCAUAAGAUAUUUUUCAUGAUUUUGAAACCAUGAAGAGAUUUUUCAUGAUUUUGAAAUCAUGAAGAUAUUUUUCCAUUUUUUUCUAAUAGUUUUAUUAAUAAACAUUCUAUCUAUUCCUGGUAGAAUAGAUAUCCACUUGAGACAGCACUAUGUAGGAAAGACCAUUUUUCCUCCACUGAACUAGGGUGGUGCAUUUUUGUAAGUUAGGUAACUGUAUGUGUGUGUGUCUGUUUCUGGGCUGUCUAUUCUAGUCUAUUUGUUGAUGCUUGUGUCAAACAGUACACUAUCUUAAUUAUUGUACAUUUAUAGUUGUAACUAUAGUCCAGCUUUGUUCUUCUUAAAGUCAAGAUUUCCAUAUAAAUAUUAGAAACAGCUUCUCAAUUUCUACAAAAUCCUGAUGAGGUUUCUACUGGGACCACAUUGAGUCUAUCAAUCAACUUAUGCAGAACUGGCAACUUACUACUGAAUCUCUAAUCAAUGUUCAUCAUGUAUCGCUUCAUGUAACUAGAAUUUCUUUAACUUAAUUGCUAUGUUUUGACAUUUUUAGUUUAAAAACCUUGUAUAUCUUGUUUUGGUGGUUUUAGUGAUUUUAAUAAUAUAUUUUAAAUAUUUUUUCUUUUCUAUUGUUGUACACAGAAAUACAGUUAAGUUUUGUGUGUAGUCUUACGAUGUUUAGUAAACUCAAUAAGUUUAUUUCUUAAAUCUAGUAAUUUGUAGAUUCCUCUGGAUUUUGUAUAUGCAUAGUCAUGUAAGCUGAAAAUAUGGCAAUACUUGCUUCUUCCCAAUUGCUUUACCUUUUUUCUUACCUUAUUGCACUGGUUAGCAACCCCAAUACAGAGACCACCAGAUCAGGUAUAGACUCCUGAAAGACAAUAUAAUGAAGUGCUCCAGUCAGGCCUAUCUAAACUGGAUUCACAGCUCUGUCACUUAAUUGCUACAUGAUCUAGAGCCAGUUACUUUGUGUUUCAGCCAUGUAUUUGCAGCUGAGAGAAAAUAAUCAUUCUUAUUUCAUGAAAAUUGUGGGGAUGAUGAAAUAAGUUAACACCUUUAAAGUGUGUAGUAAAGUAUCAGGAUACUAUAUUUUAGGUCUUAAUACACACAGUUAUGCCGCUAGAUACAUGCUUUUUAAUGAGAUAAUGUGAUAUUAUACAUAACACAUAUCGAUUUUUAAAAAUUAAAUCAACCUUGCUUUGAUGGAAUAAACUCCAUUUAGUCACA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 4153)
mannose binding lectin 2
strand -
COLEC1
NCBI CDS gene sequence (747 bp)
5'-ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCAGAAACTGTGACCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCTCCAGGCATCAACGGCTTCCCAGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGGGAACCAGGCCAAGGGCTCAGAGGCTTACAGGGCCCCCCTGGAAAGTTGGGGCCTCCAGGAAATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAAAAGGAGACCCTGGAAAAAGTCCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAACAGAAATGGCACGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTGACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCCTCTGTGGCCACCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAGGAAGCCTTCCTGGGCATCACTGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGAAATAGACTGACCTACACAAACTGGAACGAGGGTGAACCCAACAATGCTGGTTCTGATGAAGATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACGTCCCCTGCTCCACCTCCCATCTGGCCGTCTGTGAGTTCCCTATCTGA-3'
NCBI CDS gene sequence with introns (location: 52768137.. 52771635) (3499 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 52765380.. 52771652) (6273 bp)Download
NCBI gene sequence (location: [52765380.. 52771652 + 1000]) (7273 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905