Protein
Protein (NP_001177370)
Galectin 16
Galectin-16
LGALS16
galectin 16
Undefined
Low evidence
Galectin
S-Type Lectins - Prototypical
b-sandwich / ConA-like
0.389
Protein sequence and protein families (fasta) (142 amino acids) Download
MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Ligand
Glycan ligands from structural data
bGal14Glc
Gal(b1-4)Glc
References
NCBI References (2 PubMed Identifiers)
  • Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity. [33011338]
  • A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. [19497882]
UniProt Main References (1 PubMed Identifiers)
  • The DNA sequence and biology of human chromosome 19. [15057824]
RNA
RNA (Transcript ID: NM_001190441.3)
galectin 16
m7G-5')ppp(5'-ACUCAGAAGACUGGACACAAUUCCGAAGGUCGCCCAGAAGGAGAGGACAAUGUCAUUUCUAACUGUGCCAUACAAACUGCCUGUGUCUUUGUCUGUUGGUUCCUGCGUGAUAAUCAAAGGGACACUGAUCGACUCUUCUAUCAACGAACCACAGCUGCAGGUGGAUUUCUACACUGAGAUGAAUGAGGACUCAGAAAUUGCCUUCCAUUUGCGAGUGCACUUAGGCCGUCGUGUGGUCAUGAACAGUCGUGAGUUUGGGAUAUGGAUGUUGGAGGAGAAUUUACACUAUGUGCCCUUUGAGGAUGGCAAACCAUUUGACUUGCGCAUCUACGUGUGUCACAAUGAGUAUGAGGUAAAGGUAAAUGGUGAAUACAUUUAUGCCUUUGUCCAUCGAAUCCCGCCAUCAUAUGUGAAGAUGAUUCAAGUGUGGAGAGAUGUCUCCCUGGACUCAGUGCUUGUCAACAAUGGACGGAGAUGAUCACACUCCUCAUUGUUGAGGAAACCCUCUUUCUACCUGACCAUGGGAUUCCUAGAGCCUGCUAACAGAAUAAUCCCUCCUCAACCCCUUCCCCUACACUUGGUCAUUAAAACAGCACCAAACCGUA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 148003)
galectin 16
strand +
NCBI CDS gene sequence (429 bp)
5'-ATGTCATTTCTAACTGTGCCATACAAACTGCCTGTGTCTTTGTCTGTTGGTTCCTGCGTGATAATCAAAGGGACACTGATCGACTCTTCTATCAACGAACCACAGCTGCAGGTGGATTTCTACACTGAGATGAATGAGGACTCAGAAATTGCCTTCCATTTGCGAGTGCACTTAGGCCGTCGTGTGGTCATGAACAGTCGTGAGTTTGGGATATGGATGTTGGAGGAGAATTTACACTATGTGCCCTTTGAGGATGGCAAACCATTTGACTTGCGCATCTACGTGTGTCACAATGAGTATGAGGTAAAGGTAAATGGTGAATACATTTATGCCTTTGTCCATCGAATCCCGCCATCATATGTGAAGATGATTCAAGTGTGGAGAGATGTCTCCCTGGACTCAGTGCTTGTCAACAATGGACGGAGATGA-3'
NCBI CDS gene sequence with introns (location: 39655962.. 39660520) (4559 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 39655913.. 39660647) (4735 bp)Download
NCBI gene sequence (location: [39655913 - 1000].. 39660647) (5735 bp)Download
Cite How to cite