NCBI Summary
This gene is specifically expressed in Schwann cells of the peripheral nervous system and encodes a type I transmembrane glycoprotein that is a major structural protein of the peripheral myelin sheath. The encoded protein contains a large hydrophobic extracellular domain and a smaller basic intracellular domain, which are essential for the formation and stabilization of the multilamellar structure of the compact myelin. Mutations in this gene are associated with autosomal dominant form of Charcot-Marie-Tooth disease type 1 (CMT1B) and other polyneuropathies, such as Dejerine-Sottas syndrome (DSS) and congenital hypomyelinating neuropathy (CHN). A recent study showed that two isoforms are produced from the same mRNA by use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2015].
Protein
Protein (NP_000521)
Myelin protein zero
Myelin protein P0 (Myelin peripheral protein) (MPP) (Myelin protein zero)
MPZ
myelin protein zero
Undefined
Very low evidence
I-type lectin
I-Type Lectins
b-sandwich / Ig-like
MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
Mol* PDB structure viewer
Either no PDB or existing PDB of non-glycosylated form
Structural models
SWISS-MODEL structural models
The location of the lectin domain structural model is: 30-160
We infer [1.64, 2.15] Å as the interval of error of this structural model.
Template 1: 5LFR chain: A, P20917, NP_001333015.1, sequence identity: 18.3%, coverage: 100.0%, location in sequence: 19-331, (19-331 in PDB).
Template 2: 1QFO chain: A, Q62230, NP_035556.3, sequence identity: 22.1%, coverage: 84.0%, location in sequence: 20-137, (1-118 in PDB).
Template 3: 2ZG1 chain: A, O15389, NP_003821.1, sequence identity: 21.4%, coverage: 81.7%, location in sequence: 20-141, (25-146 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
We infer [1.64, 2.15] Å as the interval of error of this structural model.
Template 1: 5LFR chain: A, P20917, NP_001333015.1, sequence identity: 18.3%, coverage: 100.0%, location in sequence: 19-331, (19-331 in PDB).
Template 2: 1QFO chain: A, Q62230, NP_035556.3, sequence identity: 22.1%, coverage: 84.0%, location in sequence: 20-137, (1-118 in PDB).
Template 3: 2ZG1 chain: A, O15389, NP_003821.1, sequence identity: 21.4%, coverage: 81.7%, location in sequence: 20-141, (25-146 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (11 PubMed Identifiers)
- Phylogenetically Conserved Sequences Around Myelin P0 Stop Codon are Essential for Translational Readthrough to Produce L-MPZ. [29081003]
- L-MPZ, a novel isoform of myelin P0, is produced by stop codon readthrough. [22457349]
- Cytoplasmic domain of human myelin protein zero likely folded as beta-structure in compact myelin. [17142269]
- Peripheral neuropathies caused by mutations in the myelin protein zero. [16414078]
- Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs. [11726686]
- The major peripheral myelin protein zero gene: structure and localization in the cluster of Fc gamma receptor genes on human chromosome 1q21.3-q23. [7509228]
- Structure and chromosomal localization of the gene encoding the human myelin protein zero (MPZ). [7503936]
- Charcot-Marie-Tooth Hereditary Neuropathy Overview [20301532]
- Charcot-Marie-Tooth Neuropathy Type 2 [20301462]
- Charcot-Marie-Tooth Neuropathy Type 1 [20301384] Show more
UniProt Main References (68 PubMed Identifiers)
- Mutation of the myelin P0 gene in Charcot-Marie-tooth neuropathy type 1. [7688964]
- Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
- The DNA sequence and biological annotation of human chromosome 1. [16710414]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Deletion of the serine 34 codon from the major peripheral myelin protein P0 gene in Charcot-Marie-Tooth disease type 1B. [7693130]
- Linkage and mutation analysis in an extended family with Charcot-Marie-Tooth disease type 1B. [7530774]
- Molecular genetics of Charcot-Marie-Tooth neuropathy. [7762451]
- Charcot-Marie-Tooth disease: a new paradigm for the mechanism of inherited disease. [7518101]
- Mutations in the peripheral myelin genes and associated genes in inherited peripheral neuropathies. [9888385]
- Crystal structure of the extracellular domain of human myelin protein zero. [21971831] Show more
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_000530.8)
myelin protein zero, transcript variant 1
m7G-5')ppp(5'-AGUUCCUGGUCCCCCACUUUCUCAACCCCACAGAUGCUCCGGGCCCCUGCCCCUGCCCCAGCUAUGGCUCCUGGGGCUCCCUCAUCCAGCCCCAGCCCUAUCCUGGCUGUGCUGCUCUUCUCUUCUUUGGUGCUGUCCCCGGCCCAGGCCAUCGUGGUUUACACCGACAGGGAGGUCCAUGGUGCUGUGGGCUCCCGGGUGACCCUGCACUGCUCCUUCUGGUCCAGUGAGUGGGUCUCAGAUGACAUCUCCUUCACCUGGCGCUACCAGCCCGAAGGGGGCAGAGAUGCCAUUUCGAUCUUCCACUAUGCCAAGGGACAACCCUACAUUGACGAGGUGGGGACCUUCAAAGAGCGCAUCCAGUGGGUAGGGGACCCUCGCUGGAAGGAUGGCUCCAUUGUCAUACACAACCUAGACUACAGUGACAAUGGCACGUUCACUUGUGACGUCAAAAACCCUCCAGACAUAGUGGGCAAGACCUCUCAGGUCACGCUGUAUGUCUUUGAAAAAGUGCCAACUAGGUACGGGGUCGUUCUGGGAGCUGUGAUCGGGGGUGUCCUCGGGGUGGUGCUGUUGCUGCUGCUGCUUUUCUACGUGGUUCGGUACUGCUGGCUACGCAGGCAGGCGGCCCUGCAGAGGAGGCUCAGUGCUAUGGAGAAGGGGAAAUUGCACAAGCCAGGAAAGGACGCGUCGAAGCGCGGGCGGCAGACGCCAGUGCUGUAUGCAAUGCUGGACCACAGCAGAAGCACCAAAGCUGUCAGUGAGAAGAAGGCCAAGGGGCUGGGGGAGUCUCGCAAGGAUAAGAAAUAGCGGUUAGCGGGCCGGGCGGGGGAUCGGGGGUUAGGGGUGGAGUCCGCCAAAGGCCCAAAGGUGAUGGUCAUCGAGAUGGAGCUACGAAAGGAUGAGCAGAGCCCGGAGCUCCGGCCUGCUGUCAAGUCCCCCAGCAGAACCAGCCUCAAAAACGCCCUCAAGAACAUGAUGGGCCUGAACUCGGACAAGUGAUCGCCACCCCCCCACCCCAGGCCCUGCCAGAGCAGGGGGACCUAGGCUCCUCUUACCCCCGUCUAGGUGCUUUCCCUCUUUGCUCCCCCGCCCUGCCCUGCCCUCACCUCCCUUUGAGAUGUAAGUUUCAUUCCAGAAUUCAUUCCCCAGGCAAUUGUAUUCUCCCCCACCUUCACCCCUGGCUUUCUGGGAGCCCAGGAGCUAAUCCUACCCCUCACCUGCCCCGGGGGCUGUGUGUUUGGUGCCUGUCCACCUGAGCACUGAGAAGAAAGGGACUUUGAUACCCUCUGCCUCAAGUCCAGGCCACCUGGCAUUCCCAUCUCCUGCAUCCCCCAGCCUGUCCCCCUGGCUGUUUCCUCUCCCGUCCCUCCCUCCCCUCUACCAGGUGGCCCAGCUCCAUACUCUGUCCCCCCAGCUAAUACCCAGAGCACCCAGAUCAGACUCUCCUUCAGGGUUUAUUUAGGUUAUUAUUUUUUAUUUUUUAAUCCAUUCUUUGUUUGUUUACCUGUGCUCAUCCUCUGCCCUUACACCCAUGACUGAGGACCAAUGACGUCAUGUGGCUUUUGCAAUUCACGCCCCCCUUAAGUCCUUAAUGAAGAGCCAGCCCAAGUAGAGGGGCCCCUGAUCCUCACACUUCAGUAUAGCAUUGGUUCCCCCUGACCACUUUGGAGCACUGUUCUGGGACUCCAGGUCUUGAGGAGAGAGACAGAGAGAGAGAAUGGAUCCUCAUAGGUCAGGGAGUGGGGGAGGGGGCAAAUGAGCCUUAAGAAAUGGUUUUUAAACAACCAAACAAAAAGCAGGAAAAACAAAUGGGAAAUGGGGGGGCGGGGGGGAGGAAGAGGCUGCACUGCAGCCACAGGGGAUUCUUAGGAUUUUUCUACAUUCUGUAUAUUUCUUCUCAAACCUCCAAAUGUCCUUAAAUGUUUAAUAAACACUGACAUUUCCAGAA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 4359)
myelin protein zero
strand -
HMSNIB, CMT2I, CMT2J, P0
NCBI CDS gene sequence (747 bp)
5'-ATGGCTCCTGGGGCTCCCTCATCCAGCCCCAGCCCTATCCTGGCTGTGCTGCTCTTCTCTTCTTTGGTGCTGTCCCCGGCCCAGGCCATCGTGGTTTACACCGACAGGGAGGTCCATGGTGCTGTGGGCTCCCGGGTGACCCTGCACTGCTCCTTCTGGTCCAGTGAGTGGGTCTCAGATGACATCTCCTTCACCTGGCGCTACCAGCCCGAAGGGGGCAGAGATGCCATTTCGATCTTCCACTATGCCAAGGGACAACCCTACATTGACGAGGTGGGGACCTTCAAAGAGCGCATCCAGTGGGTAGGGGACCCTCGCTGGAAGGATGGCTCCATTGTCATACACAACCTAGACTACAGTGACAATGGCACGTTCACTTGTGACGTCAAAAACCCTCCAGACATAGTGGGCAAGACCTCTCAGGTCACGCTGTATGTCTTTGAAAAAGTGCCAACTAGGTACGGGGTCGTTCTGGGAGCTGTGATCGGGGGTGTCCTCGGGGTGGTGCTGTTGCTGCTGCTGCTTTTCTACGTGGTTCGGTACTGCTGGCTACGCAGGCAGGCGGCCCTGCAGAGGAGGCTCAGTGCTATGGAGAAGGGGAAATTGCACAAGCCAGGAAAGGACGCGTCGAAGCGCGGGCGGCAGACGCCAGTGCTGTATGCAATGCTGGACCACAGCAGAAGCACCAAAGCTGTCAGTGAGAAGAAGGCCAAGGGGCTGGGGGAGTCTCGCAAGGATAAGAAATAG-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.