Protein
Protein (NP_660295)
Zymogen granule protein 16 homolog B
Zymogen granule protein 16 homolog B
ZG16B
zymogen granule protein 16B
Undefined
Curated
Jacalin-like
Undefined
b-prism I
Streptococcus cell wall
Undefined
0.432
Protein sequence and protein families (fasta) (172 amino acids) Download
MLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • PAUF/ZG16B promotes colorectal cancer progression through alterations of the mitotic functions and the Wnt/beta-catenin pathway. [31095674]
  • A reference map of the human binary protein interactome. [32296183]
  • DCPP1 is the mouse ortholog of human PAUF that possesses functional analogy in pancreatic cancer. [28988106]
  • Pancreatic adenocarcinoma up-regulated factor has oncogenic functions in oral squamous cell carcinoma. [27706833]
  • Pancreatic adenocarcinoma up-regulated factor (PAUF) enhances the accumulation and functional activity of myeloid-derived suppressor cells (MDSCs) in pancreatic cancer. [27322081]
  • Identification of a human ortholog of the mouse Dcpp gene locus, encoding a novel member of the CSP-1/Dcpp salivary protein family. [16954406]
  • Human colostrum: identification of minor proteins in the aqueous phase by proteomics. [16502470]
  • Transcriptome analysis of human gastric cancer. [16341674]
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Mass spectrometry allows direct identification of proteins in large genomes. [11678034]
UniProt Main References (4 PubMed Identifiers)
  • The sequence and analysis of duplication-rich human chromosome 16. [15616553]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • Crystal structures of human secretory proteins ZG16p and ZG16b reveal a Jacalin-related beta-prism fold. [21110947]
RNA
RNA (Transcript ID: NM_145252.3)
zymogen granule protein 16B
m7G-5')ppp(5'-CAACCAGACGCCCAGUCACAGGCGAGAGCCCUGGGAUGCACCGGCCAGAGGCCAUGCUGCUGCUGCUCACGCUUGCCCUCCUGGGGGGCCCCACCUGGGCAGGGAAGAUGUAUGGCCCUGGAGGAGGCAAGUAUUUCAGCACCACUGAAGACUACGACCAUGAAAUCACAGGGCUGCGGGUGUCUGUAGGUCUUCUCCUGGUGAAAAGUGUCCAGGUGAAACUUGGAGACUCCUGGGACGUGAAACUGGGAGCCUUAGGUGGGAAUACCCAGGAAGUCACCCUGCAGCCAGGCGAAUACAUCACAAAAGUCUUUGUCGCCUUCCAAGCUUUCCUCCGGGGUAUGGUCAUGUACACCAGCAAGGACCGCUAUUUCUAUUUUGGGAAGCUUGAUGGCCAGAUCUCCUCUGCCUACCCCAGCCAAGAGGGGCAGGUGCUGGUGGGCAUCUAUGGCCAGUAUCAACUCCUUGGCAUCAAGAGCAUUGGCUUUGAAUGGAAUUAUCCACUAGAGGAGCCGACCACUGAGCCACCAGUUAAUCUCACAUACUCAGCAAACUCACCCGUGGGUCGCUAGGGUGGGGUAUGGGGCCAUCCGAGCUGAGGCCAUCUGGGUGGUGGUGGCUGAUGGUACUGGAGUAACUGAGUCGGGACGCUGAAUCUGAAUCCACCAAUAAAUAAAGGUUCUGCAGAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 124220)
zymogen granule protein 16B
strand +
HRPE773, PRO1567, JCLN2
NCBI CDS gene sequence (519 bp)
5'-ATGCTGCTGCTGCTCACGCTTGCCCTCCTGGGGGGCCCCACCTGGGCAGGGAAGATGTATGGCCCTGGAGGAGGCAAGTATTTCAGCACCACTGAAGACTACGACCATGAAATCACAGGGCTGCGGGTGTCTGTAGGTCTTCTCCTGGTGAAAAGTGTCCAGGTGAAACTTGGAGACTCCTGGGACGTGAAACTGGGAGCCTTAGGTGGGAATACCCAGGAAGTCACCCTGCAGCCAGGCGAATACATCACAAAAGTCTTTGTCGCCTTCCAAGCTTTCCTCCGGGGTATGGTCATGTACACCAGCAAGGACCGCTATTTCTATTTTGGGAAGCTTGATGGCCAGATCTCCTCTGCCTACCCCAGCCAAGAGGGGCAGGTGCTGGTGGGCATCTATGGCCAGTATCAACTCCTTGGCATCAAGAGCATTGGCTTTGAATGGAATTATCCACTAGAGGAGCCGACCACTGAGCCACCAGTTAATCTCACATACTCAGCAAACTCACCCGTGGGTCGCTAG-3'
NCBI CDS gene sequence with introns (location: 2830442.. 2832159) (1718 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 2830303.. 2832276) (1974 bp)Download
NCBI gene sequence (location: [2830303 - 1000].. 2832276) (2974 bp)Download
Cite How to cite