Protein
Protein (NP_660295)
Zymogen granule protein 16 homolog B
Zymogen granule protein 16 homolog B
ZG16B
zymogen granule protein 16B
Undefined
Curated
Jacalin-like
Undefined
b-prism I
Streptococcus cell wall
Undefined
0.432
Protein sequence and protein families (fasta) (172 amino acids) Download
MLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Oligomerization and Known Interactions
Interacts with MUC7; this interaction enhances the capture of commensal bacteria and promotes their removal via the mucin-assisted clearance pathway (PubMed:37216558). Found in a complex with the salivary mucin MUC7 and with Streptococcus vestibularis (PubMed:37216558). Source: UniProt
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • PAUF/ZG16B promotes colorectal cancer progression through alterations of the mitotic functions and the Wnt/beta-catenin pathway. [31095674]
  • A reference map of the human binary protein interactome. [32296183]
  • DCPP1 is the mouse ortholog of human PAUF that possesses functional analogy in pancreatic cancer. [28988106]
  • Pancreatic adenocarcinoma up-regulated factor has oncogenic functions in oral squamous cell carcinoma. [27706833]
  • Pancreatic adenocarcinoma up-regulated factor (PAUF) enhances the accumulation and functional activity of myeloid-derived suppressor cells (MDSCs) in pancreatic cancer. [27322081]
  • Identification of a human ortholog of the mouse Dcpp gene locus, encoding a novel member of the CSP-1/Dcpp salivary protein family. [16954406]
  • Human colostrum: identification of minor proteins in the aqueous phase by proteomics. [16502470]
  • Transcriptome analysis of human gastric cancer. [16341674]
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Mass spectrometry allows direct identification of proteins in large genomes. [11678034]
UniProt Main References (4 PubMed Identifiers)
  • The sequence and analysis of duplication-rich human chromosome 16. [15616553]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • Crystal structures of human secretory proteins ZG16p and ZG16b reveal a Jacalin-related beta-prism fold. [21110947]
RNA
RNA (Transcript ID: NM_145252.3)
zymogen granule protein 16B
m7G-5')ppp(5'-CAACCAGACGCCCAGUCACAGGCGAGAGCCCUGGGAUGCACCGGCCAGAGGCCAUGCUGCUGCUGCUCACGCUUGCCCUCCUGGGGGGCCCCACCUGGGCAGGGAAGAUGUAUGGCCCUGGAGGAGGCAAGUAUUUCAGCACCACUGAAGACUACGACCAUGAAAUCACAGGGCUGCGGGUGUCUGUAGGUCUUCUCCUGGUGAAAAGUGUCCAGGUGAAACUUGGAGACUCCUGGGACGUGAAACUGGGAGCCUUAGGUGGGAAUACCCAGGAAGUCACCCUGCAGCCAGGCGAAUACAUCACAAAAGUCUUUGUCGCCUUCCAAGCUUUCCUCCGGGGUAUGGUCAUGUACACCAGCAAGGACCGCUAUUUCUAUUUUGGGAAGCUUGAUGGCCAGAUCUCCUCUGCCUACCCCAGCCAAGAGGGGCAGGUGCUGGUGGGCAUCUAUGGCCAGUAUCAACUCCUUGGCAUCAAGAGCAUUGGCUUUGAAUGGAAUUAUCCACUAGAGGAGCCGACCACUGAGCCACCAGUUAAUCUCACAUACUCAGCAAACUCACCCGUGGGUCGCUAGGGUGGGGUAUGGGGCCAUCCGAGCUGAGGCCAUCUGGGUGGUGGUGGCUGAUGGUACUGGAGUAACUGAGUCGGGACGCUGAAUCUGAAUCCACCAAUAAAUAAAGGUUCUGCAGAA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 124220)
zymogen granule protein 16B
strand +
HRPE773, PRO1567, JCLN2
NCBI CDS gene sequence (519 bp)
5'-ATGCTGCTGCTGCTCACGCTTGCCCTCCTGGGGGGCCCCACCTGGGCAGGGAAGATGTATGGCCCTGGAGGAGGCAAGTATTTCAGCACCACTGAAGACTACGACCATGAAATCACAGGGCTGCGGGTGTCTGTAGGTCTTCTCCTGGTGAAAAGTGTCCAGGTGAAACTTGGAGACTCCTGGGACGTGAAACTGGGAGCCTTAGGTGGGAATACCCAGGAAGTCACCCTGCAGCCAGGCGAATACATCACAAAAGTCTTTGTCGCCTTCCAAGCTTTCCTCCGGGGTATGGTCATGTACACCAGCAAGGACCGCTATTTCTATTTTGGGAAGCTTGATGGCCAGATCTCCTCTGCCTACCCCAGCCAAGAGGGGCAGGTGCTGGTGGGCATCTATGGCCAGTATCAACTCCTTGGCATCAAGAGCATTGGCTTTGAATGGAATTATCCACTAGAGGAGCCGACCACTGAGCCACCAGTTAATCTCACATACTCAGCAAACTCACCCGTGGGTCGCTAG-3'
NCBI CDS gene sequence with introns (location: 2830442.. 2832159) (1718 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 2830303.. 2832276) (1974 bp)Download
NCBI gene sequence (location: [2830303 - 1000].. 2832276) (2974 bp)Download
Cite How to cite