Protein
Protein (NP_001177694)
KLRF2 / Killer cell lectin-like receptor F member 2
Killer cell lectin-like receptor subfamily F member 2 (Lectin-like receptor F2) (Activating coreceptor NKp65)
KLRF2
killer cell lectin like receptor F2
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
Uncharacterised
0.331
Undefined
Protein sequence and protein families (fasta) (207 amino acids) Download
MENEDGYMTLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIVILIFIMTGIDLKFWHKKMDFSQNVNVSSLSGHNYLCPNDWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLYVTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGNWVYSEDCSSTFKGICQRDAILTHNGTSGV
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (4 PubMed Identifiers)
  • The Activating C-type Lectin-like Receptor NKp65 Signals through a Hemi-immunoreceptor Tyrosine-based Activation Motif (hemITAM) and Spleen Tyrosine Kinase (Syk). [28082678]
  • Key residues at the membrane-distal surface of KACL, but not glycosylation, determine the functional interaction of the keratinocyte-specific C-type lectin-like receptor KACL with its high-affinity receptor NKp65. [25510854]
  • Structure of NKp65 bound to its keratinocyte ligand reveals basis for genetically linked recognition in natural killer gene complex. [23803857]
  • Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. [20194751]
UniProt Main References (1 PubMed Identifiers)
  • The finished DNA sequence of human chromosome 12. [16541075]
RNA
RNA (Transcript ID: NM_001190765.1)
killer cell lectin like receptor F2
m7G-5')ppp(5'-AGUUUUCUUUUAGUACCUUGUGCCAAAGAGACAUAUCCAAGGUUGAGAUUAGUUUCCAUUUUCUUUGUACUAUUUUCUGGAUAAUAAGACAUUAGACAUUUGAAGAGAUGGAGAAUGAAGAUGGGUAUAUGACGCUGAGUUUCAAGAAUCGUUGUAAAUCGAAGCAGAAAUCUAAAGAUUUCUCCCUAUAUCCACAAUAUUAUUGUCUUCUGCUCAUAUUUGGAUGCAUUGUGAUCCUUAUAUUCAUUAUGACAGGGAUUGACCUGAAGUUCUGGCAUAAAAAAAUGGAUUUCUCCCAGAAUGUAAACGUCAGCAGUCUAUCAGGACACAAUUACUUGUGCCCAAAUGACUGGCUGUUGAACGAAGGGAAAUGUUACUGGUUUUCAACUUCUUUUAAAACGUGGAAAGAGAGUCAACGUGAUUGUACACAGCUACAGGCACAUUUACUGGUGAUUCAAAAUUUGGAUGAGCUGGAGUUCAUACAGAACAGUUUAAAACCUGGACAUUUUGGUUGGAUUGGACUAUAUGUUACAUUCCAAGGGAACCUAUGGAUGUGGAUAGAUGAACACUUUUUAGUUCCAGAAUUGUUUUCAGUGAUUGGACCAACUGAUGACAGGAGCUGUGCCGUUAUCACAGGAAACUGGGUGUAUUCUGAAGACUGUAGCUCCACAUUUAAGGGCAUUUGCCAGAGAGAUGCGAUCUUGACGCACAAUGGAACCAGUGGUGUGUAA-3'- Poly-A tail
  • Coding region
;
DNA
killer cell lectin like receptor F2
strand +
NKp65
NCBI CDS gene sequence (624 bp)
5'-ATGGAGAATGAAGATGGGTATATGACGCTGAGTTTCAAGAATCGTTGTAAATCGAAGCAGAAATCTAAAGATTTCTCCCTATATCCACAATATTATTGTCTTCTGCTCATATTTGGATGCATTGTGATCCTTATATTCATTATGACAGGGATTGACCTGAAGTTCTGGCATAAAAAAATGGATTTCTCCCAGAATGTAAACGTCAGCAGTCTATCAGGACACAATTACTTGTGCCCAAATGACTGGCTGTTGAACGAAGGGAAATGTTACTGGTTTTCAACTTCTTTTAAAACGTGGAAAGAGAGTCAACGTGATTGTACACAGCTACAGGCACATTTACTGGTGATTCAAAATTTGGATGAGCTGGAGTTCATACAGAACAGTTTAAAACCTGGACATTTTGGTTGGATTGGACTATATGTTACATTCCAAGGGAACCTATGGATGTGGATAGATGAACACTTTTTAGTTCCAGAATTGTTTTCAGTGATTGGACCAACTGATGACAGGAGCTGTGCCGTTATCACAGGAAACTGGGTGTATTCTGAAGACTGTAGCTCCACATTTAAGGGCATTTGCCAGAGAGATGCGATCTTGACGCACAATGGAACCAGTGGTGTGTAA-3'
NCBI CDS gene sequence with introns (location: 9881596.. 9895833) (14238 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 9881489.. 9895833) (14345 bp)Download
NCBI gene sequence (location: [9881489 - 1000].. 9895833) (15345 bp)Download
Cite How to cite