NCBI Summary
This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_002548)
Oviductin
Oviduct-specific glycoprotein (Estrogen-dependent oviduct protein) (Mucin-9) (Oviductal glycoprotein) (Oviductin)
OVGP1
oviductal glycoprotein 1
Undefined
Low evidence
chi-lectin TIM
Chilectins
a/b barrel / TIM
GlcNAc(b1-4)GlcNAc / Chitooligosaccharides
Undefined
Protein sequence and protein families (fasta) (678 amino acids) Download
MWKLLLWVGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKDLQDEKILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFFLYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINVLSYDLHGSWERFTGHNSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQARAIGPASPGKYTKQEGFLAYFEICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTDSKILPPGGEAGVTEIHGKCENMTITPRGTTVTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Human OVGP1 enhances tyrosine phosphorylation of proteins in the fibrous sheath involving AKAP3 and increases sperm-zona binding. [31254143]
  • Oviductal glycoprotein 1 (OVGP1) is expressed by endometrial epithelium that regulates receptivity and trophoblast adhesion. [29968069]
  • Reduced expression of mucin 9 (MUC9) in patients with ulcerative colitis. [22028245]
  • Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study. [20800603]
  • Oviductal glycoprotein (OVGP1, MUC9): a differentiation-based mucin present in serum of women with ovarian cancer. [20130498]
  • Variable expression of oviductin mRNA at different stages of human reproductive cycle. [12503889]
  • Cloning and characterization of the human oviduct-specific glycoprotein (HuOGP) gene promoter. [11818519]
  • Allelic polymorphism and chromosomal localization of the human oviductin gene (MUC9). [9341614]
  • Complementary deoxyribonucleic acid cloning and molecular characterization of an estrogen-dependent human oviductal glycoprotein. [7819450]
  • The in vitro synthesis and release of proteins by the human oviduct. [3278893]
UniProt Main References (3 PubMed Identifiers)
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • The consensus coding sequences of human breast and colorectal cancers. [16959974]
RNA
RNA (Transcript ID: NM_002557.4)
oviductal glycoprotein 1
m7G-5')ppp(5'-AUCAGACCAUUGAGAUGUGGAAGCUGUUGCUGUGGGUUGGGCUGGUUCUUGUGCUGAAACACCACGAUGGUGCUGCCCAUAAACUCGUGUGUUAUUUCACCAACUGGGCACACAGUCGGCCAGGCCCUGCCUCGAUCUUGCCCCAUGACCUGGACCCCUUUCUCUGCACCCACCUGAUAUUUGCCUUUGCCUCAAUGAACAACAAUCAGAUUGUUGCUAAGGAUCUCCAGGAUGAGAAAAUUCUCUACCCAGAGUUCAACAAACUAAAGGAGAGGAACAGAGAGCUGAAAACACUACUGUCCAUCGGCGGGUGGAACUUUGGCACCUCAAGAUUCACCACUAUGUUGUCCACAUUUGCCAACCGUGAAAAGUUUAUUGCUUCAGUUAUAUCCCUUCUGAGGACACAUGACUUUGAUGGUCUUGACCUUUUCUUCUUAUAUCCUGGACUAAGAGGCAGCCCCAUGCAUGACCGGUGGACUUUUCUCUUCUUAAUUGAAGAGCUCCUGUUUGCCUUCCGGAAGGAGGCACUGCUCACCAUGCGCCCGAGGCUGCUGCUGUCUGCUGCUGUUUCUGGGGUCCCACACAUCGUCCAAACAUCCUAUGAUGUGCGCUUUCUAGGAAGACUCCUGGAUUUCAUCAAUGUCUUGUCUUAUGACUUACAUGGAAGUUGGGAAAGGUUCACAGGACAUAAUAGCCCCCUCUUCUCUCUGCCUGAAGACCCCAAAUCUUCGGCAUAUGCUAUGAAUUAUUGGAGAAAGCUUGGGGCACCCUCAGAGAAGCUCAUCAUGGGGAUCCCCACCUAUGGACGUACCUUUCGCCUCCUCAAAGCCUCUAAGAAUGGGUUGCAGGCCAGAGCGAUCGGACCAGCAUCUCCAGGGAAGUACACCAAGCAAGAAGGCUUCUUGGCUUAUUUUGAGAUUUGUUCCUUUGUCUGGGGAGCGAAGAAGCACUGGAUUGAUUACCAGUAUGUCCCGUAUGCCAACAAGGGGAAAGAGUGGGUUGGCUAUGACAAUGCCAUCAGCUUCAGUUACAAGGCAUGGUUUAUAAGGCGAGAGCAUUUUGGGGGGGCCAUGGUGUGGACAUUGGACAUGGAUGACGUCAGGGGCACGUUCUGUGGCACUGGCCCUUUCCCCCUUGUCUACGUAUUGAAUGAUAUCCUGGUGCGGGCUGAGUUCAGUUCAACUUCUUUACCACAAUUUUGGCUGUCAUCUGCUGUGAAUUCUUCAAGCACUGACCCUGAAAGGCUGGCUGUGACCACGGCAUGGACCACUGAUAGUAAGAUUUUGCCCCCAGGAGGAGAGGCUGGGGUCACUGAGAUCCACGGAAAGUGUGAAAAUAUGACUAUAACCCCUAGAGGUACAACUGUGACCCCUACAAAGGAAACUGUAUCCCUUGGAAAGCACACUGUAGCUCUAGGAGAGAAGACUGAGAUCACUGGGGCAAUGACCAUGACUUCUGUGGGUCAUCAGUCCAUGACCCCUGGAGAGAAGGCCCUGACCCCUGUGGGUCAUCAAUCUGUGACCACUGGACAGAAGACCCUGACCUCUGUGGGUUAUCAGUCUGUGACCCCUGGGGAAAAGACCCUGACCCCUGUGGGUCAUCAGUCUGUGACCCCUGUGAGUCAUCAGUCUGUGAGCCCUGGAGGAACGACUAUGACCCCUGUCCAUUUUCAGACUGAGACCCUUAGACAGAAUACAGUGGCCCCUAGAAGGAAGGCUGUGGCCCGUGAAAAGGUGACUGUCCCCUCCAGAAACAUAUCAGUCACCCCUGAAGGGCAGACUAUGCCUUUAAGAGGGGAGAAUUUGACUUCUGAGGUGGGCACUCACCCCAGGAUGGGUAACUUGGGUCUUCAGAUGGAAGCUGAAAACAGGAUGAUGCUGUCCUCCAGCCCCGUCAUCCAGCUCCCGGAACAAACUCCUCUAGCUUUUGACAACCGCUUUGUUCCCAUCUAUGGAAACCAUUCCUCUGUCAACUCAGUAACCCCUCAAACAAGUCCUCUUUCUCUAAAAAAAGAAAUCCCAGAAAACUCUGCUGUGGAUGAAGAAGCCUAAGCCCCUCUGGUGUCAGAAACCAGGGAAAACCCUUGUCUUUUCUUCUAAGUGACAUGUUGGAAGCCUUCUCAUCCCGGGGCAAAGCAGGCAUCAAAACCAGAAUAGGCCAAUCUCUUUUCCAUUAAAUAAACUGUAAACACAAGAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 5016)
oviductal glycoprotein 1
strand -
CHIT5
NCBI CDS gene sequence (2037 bp)
5'-ATGTGGAAGCTGTTGCTGTGGGTTGGGCTGGTTCTTGTGCTGAAACACCACGATGGTGCTGCCCATAAACTCGTGTGTTATTTCACCAACTGGGCACACAGTCGGCCAGGCCCTGCCTCGATCTTGCCCCATGACCTGGACCCCTTTCTCTGCACCCACCTGATATTTGCCTTTGCCTCAATGAACAACAATCAGATTGTTGCTAAGGATCTCCAGGATGAGAAAATTCTCTACCCAGAGTTCAACAAACTAAAGGAGAGGAACAGAGAGCTGAAAACACTACTGTCCATCGGCGGGTGGAACTTTGGCACCTCAAGATTCACCACTATGTTGTCCACATTTGCCAACCGTGAAAAGTTTATTGCTTCAGTTATATCCCTTCTGAGGACACATGACTTTGATGGTCTTGACCTTTTCTTCTTATATCCTGGACTAAGAGGCAGCCCCATGCATGACCGGTGGACTTTTCTCTTCTTAATTGAAGAGCTCCTGTTTGCCTTCCGGAAGGAGGCACTGCTCACCATGCGCCCGAGGCTGCTGCTGTCTGCTGCTGTTTCTGGGGTCCCACACATCGTCCAAACATCCTATGATGTGCGCTTTCTAGGAAGACTCCTGGATTTCATCAATGTCTTGTCTTATGACTTACATGGAAGTTGGGAAAGGTTCACAGGACATAATAGCCCCCTCTTCTCTCTGCCTGAAGACCCCAAATCTTCGGCATATGCTATGAATTATTGGAGAAAGCTTGGGGCACCCTCAGAGAAGCTCATCATGGGGATCCCCACCTATGGACGTACCTTTCGCCTCCTCAAAGCCTCTAAGAATGGGTTGCAGGCCAGAGCGATCGGACCAGCATCTCCAGGGAAGTACACCAAGCAAGAAGGCTTCTTGGCTTATTTTGAGATTTGTTCCTTTGTCTGGGGAGCGAAGAAGCACTGGATTGATTACCAGTATGTCCCGTATGCCAACAAGGGGAAAGAGTGGGTTGGCTATGACAATGCCATCAGCTTCAGTTACAAGGCATGGTTTATAAGGCGAGAGCATTTTGGGGGGGCCATGGTGTGGACATTGGACATGGATGACGTCAGGGGCACGTTCTGTGGCACTGGCCCTTTCCCCCTTGTCTACGTATTGAATGATATCCTGGTGCGGGCTGAGTTCAGTTCAACTTCTTTACCACAATTTTGGCTGTCATCTGCTGTGAATTCTTCAAGCACTGACCCTGAAAGGCTGGCTGTGACCACGGCATGGACCACTGATAGTAAGATTTTGCCCCCAGGAGGAGAGGCTGGGGTCACTGAGATCCACGGAAAGTGTGAAAATATGACTATAACCCCTAGAGGTACAACTGTGACCCCTACAAAGGAAACTGTATCCCTTGGAAAGCACACTGTAGCTCTAGGAGAGAAGACTGAGATCACTGGGGCAATGACCATGACTTCTGTGGGTCATCAGTCCATGACCCCTGGAGAGAAGGCCCTGACCCCTGTGGGTCATCAATCTGTGACCACTGGACAGAAGACCCTGACCTCTGTGGGTTATCAGTCTGTGACCCCTGGGGAAAAGACCCTGACCCCTGTGGGTCATCAGTCTGTGACCCCTGTGAGTCATCAGTCTGTGAGCCCTGGAGGAACGACTATGACCCCTGTCCATTTTCAGACTGAGACCCTTAGACAGAATACAGTGGCCCCTAGAAGGAAGGCTGTGGCCCGTGAAAAGGTGACTGTCCCCTCCAGAAACATATCAGTCACCCCTGAAGGGCAGACTATGCCTTTAAGAGGGGAGAATTTGACTTCTGAGGTGGGCACTCACCCCAGGATGGGTAACTTGGGTCTTCAGATGGAAGCTGAAAACAGGATGATGCTGTCCTCCAGCCCCGTCATCCAGCTCCCGGAACAAACTCCTCTAGCTTTTGACAACCGCTTTGTTCCCATCTATGGAAACCATTCCTCTGTCAACTCAGTAACCCCTCAAACAAGTCCTCTTTCTCTAAAAAAAGAAATCCCAGAAAACTCTGCTGTGGATGAAGAAGCCTAA-3'
NCBI CDS gene sequence with introns (location: 111414464.. 111427721) (13258 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 111414319.. 111427735) (13417 bp)Download
NCBI gene sequence (location: [111414319.. 111427735 + 1000]) (14417 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905