NCBI Summary
CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors (Spreu et al., 2007 [PubMed 18046548]).[supplied by OMIM, May 2008].
Protein
Protein (NP_001124183)
C-type lectin domain family 2 member A
C-type lectin domain family 2 member A (Keratinocyte-associated C-type lectin) (KACL) (Proliferation-induced lymphocyte-associated receptor) (PILAR)
CLEC2A
C-type lectin domain family 2 member A
Undefined
Very low evidence
C-type lectin
Undefined
C-type - Natural Killer NK
a/b mixed / C-type lectin-like
Uncharacterised
0.217
Undefined
Protein sequence and protein families (fasta) (174 amino acids) Download
MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • NK Cell and Fibroblast-Mediated Regulation of Skin Squamous Cell Carcinoma Invasion by CLEC2A Is Compromised in Xeroderma Pigmentosum. [32061658]
  • A reference map of the human binary protein interactome. [32296183]
  • A Comprehensive Tyrosine Phosphoproteomic Analysis Reveals Novel Components of the Platelet CLEC-2 Signaling Cascade. [31901221]
  • Physiologic and pathophysiologic roles of interaction between C-type lectin-like receptor 2 and podoplanin: partners from in utero to adulthood. [27960039]
  • PDGF upregulates CLEC-2 to induce T regulatory cells. [26416420]
  • Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes. [20194751]
  • Novel interactions in platelet biology: CLEC-2/podoplanin and laminin/GPVI. [19630798]
  • PILAR is a novel modulator of human T-cell expansion. [18550855]
  • CLEC2A: a novel, alternatively spliced and skin-associated member of the NKC-encoded AICL-CD69-LLT1 family. [18046548]
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
UniProt Main References (2 PubMed Identifiers)
  • N-terminome analysis of the human mitochondrial proteome. [25944712]
  • Structure of NKp65 bound to its keratinocyte ligand reveals basis for genetically linked recognition in natural killer gene complex. [23803857]
All isoforms of this gene containing a lectin domain
XP_011518956.1, XP_011518958.1, XP_011518959.1, NP_001124183.1, NP_997258.1
RNA
RNA (Transcript ID: NM_001130711.2)
C-type lectin domain family 2 member A, transcript variant 1
m7G-5')ppp(5'-CUAGUCCUCUCCUACUGAUCUCCAUCGGUUAGCGCCUUGCCAUGAUUAAUCCAGAGCUGCGGGAUGGCAGAGCUGAUGGCUUCAUACAUCGGAUAGUUCCCAAGUUGAUACAAAACUGGAAGAUUGGCCUUAUGUGCUUCCUGAGUAUUAUUAUUACUACAGUUUGCAUUAUUAUGAUAGCCACAUGGUCCAAGCAUGCUAAACCUGUGGCAUGUUCAGGGGACUGGCUUGGAGUGAGAGAUAAGUGUUUCUAUUUUUCUGAUGAUACCAGAAAUUGGACAGCCAGUAAAAUAUUUUGUAGUUUGCAGAAAGCAGAACUUGCUCAGAUUGAUACACAAGAAGACAUGGAAUUUUUGAAGAGGUACGCAGGAACUGAUAUGCACUGGAUUGGACUAAGCAGGAAACAAGGAGAUUCUUGGAAAUGGACAAAUGGCACCACAUUCAAUGGUUGGUUUGAAAUUAUAGGGAACGGAUCCUUUGCUUUCUUGAGUGCUGAUGGAGUCCAUAGUUCCAGAGGAUUUAUUGAUAUCAAGUGGAUUUGCAGCAAACCUAAAUAUUUUUUAUAGAGCAGAAAAAACUUGAAAAUGAUUAUCACACUUCAAGAUUGAAAGAAGAGCUAAUUAUGCAAAAGUGGCUUUCUCACUUAUUCUGUUACAGAAUACGGAACCUCUGGUGAGGGCCCAUUUUCUAGUUUAUAGAUGGAAACUUCUUGCUGUGCCCUGCCAUGGUUAAAGAGACAAGGCCGUUCUCUGGAGCCUUUUAUAAGGGCACAAUCACAUUUACUAUGGCUCCAUCCUCAUGAACUAAUCACCUCCUGAUGGAUGGCUCCAUCCCCUAAUACCAUCACACUGGUGAUUAGCUUUCAAUUUAUGAGUUUUGGGAGGACCCAAAUACUCAGAACAUAG-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 387836)
C-type lectin domain family 2 member A
strand -
UNQ5792, INPE5792, KACL, PILAR
NCBI CDS gene sequence (525 bp)
5'-ATGATTAATCCAGAGCTGCGGGATGGCAGAGCTGATGGCTTCATACATCGGATAGTTCCCAAGTTGATACAAAACTGGAAGATTGGCCTTATGTGCTTCCTGAGTATTATTATTACTACAGTTTGCATTATTATGATAGCCACATGGTCCAAGCATGCTAAACCTGTGGCATGTTCAGGGGACTGGCTTGGAGTGAGAGATAAGTGTTTCTATTTTTCTGATGATACCAGAAATTGGACAGCCAGTAAAATATTTTGTAGTTTGCAGAAAGCAGAACTTGCTCAGATTGATACACAAGAAGACATGGAATTTTTGAAGAGGTACGCAGGAACTGATATGCACTGGATTGGACTAAGCAGGAAACAAGGAGATTCTTGGAAATGGACAAATGGCACCACATTCAATGGTTGGTTTGAAATTATAGGGAACGGATCCTTTGCTTTCTTGAGTGCTGATGGAGTCCATAGTTCCAGAGGATTTATTGATATCAAGTGGATTTGCAGCAAACCTAAATATTTTTTATAG-3'
NCBI CDS gene sequence with introns (location: 9913566.. 9932329) (18764 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 9913227.. 9932370) (19144 bp)Download
NCBI gene sequence (location: [9913227.. 9932370 + 1000]) (20144 bp)Download
Cite How to cite