NCBI Summary
This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_004473)
CBM13-ppGalNAc-T3
Polypeptide N-acetylgalactosaminyltransferase 3 (EC 2.4.1.41) (Polypeptide GalNAc transferase 3) (GalNAc-T3) (pp-GaNTase 3) (Protein-UDP acetylgalactosaminyltransferase 3) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3)
GALNT3
polypeptide N-acetylgalactosaminyltransferase 3
Undefined
Curated
Ricin-like
R-Type Lectins
b-trefoil
GalNAc / Mucin-type glycopeptide
Undefined
Protein sequence and protein families (fasta) (633 amino acids) Download
MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQND
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [1.34, 1.65] ÅDownload
The location of the lectin domain structural model is: 286-632
We infer [1.34, 1.65] Å as the interval of error of this structural model.
Template: 1XHB chain: A, O08912, NP_001153876.1, sequence identity: 43.2%, coverage: 94.2%, location in sequence: 95-553, (95-553 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • miR-885-5p inhibits proliferation and metastasis by targeting IGF2BP1 and GALNT3 in human intrahepatic cholangiocarcinoma. [33052627]
  • GalNAc-T3 and MUC1, a combined predictor of prognosis and recurrence in solitary pulmonary adenocarcinoma initially diagnosed as malignant solitary pulmonary nodule (<= 3 cm). [32776306]
  • Hyperphosphatemic familial tumoral calcinosis caused by a novel variant in the GALNT3 gene. [32125652]
  • The polypeptide GALNT6 Displays Redundant Functions upon Suppression of its Closest Homolog GALNT3 in Mediating Aberrant O-Glycosylation, Associated with Ovarian Cancer Progression. [31071912]
  • GALNT3 Maintains the Epithelial State in Trophoblast Stem Cells. [30917321]
  • Genomic organization and chromosomal localization of three members of the UDP-N-acetylgalactosamine: polypeptide N-acetylgalactosaminyltransferase family. [9592121]
  • Localization of three human polypeptide GalNAc-transferases in HeLa cells suggests initiation of O-linked glycosylation throughout the Golgi apparatus. [9394011]
  • Substrate specificities of three members of the human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase family, GalNAc-T1, -T2, and -T3. [9295285]
  • cDNA cloning and expression of a novel human UDP-N-acetyl-alpha-D-galactosamine. Polypeptide N-acetylgalactosaminyltransferase, GalNAc-t3. [8663203]
  • 29389098
UniProt Main References (7 PubMed Identifiers)
  • Generation and annotation of the DNA sequences of human chromosomes 2 and 4. [15815621]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Prognostic significance of UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-3 (GalNAc-T3) expression in patients with gastric carcinoma. [12708471]
  • Mutations in GALNT3, encoding a protein involved in O-linked glycosylation, cause familial tumoral calcinosis. [15133511]
  • Identification of a recurrent mutation in GALNT3 demonstrates that hyperostosis-hyperphosphatemia syndrome and familial tumoral calcinosis are allelic disorders. [15599692]
  • Polypeptide GalNAc-transferase T3 and familial tumoral calcinosis. Secretion of fibroblast growth factor 23 requires O-glycosylation. [16638743]
  • Initial characterization of the human central proteome. [21269460]
RNA
RNA (Transcript ID: NM_004482.4)
polypeptide N-acetylgalactosaminyltransferase 3
m7G-5')ppp(5'-AGCUCACCUGGGAGACUCCAAGUGGAAGCCGAGCCUCGGUUCUGCCUCUCCAGGCAACGCGGGAGGCCCAGCGGGAAGGCAGGAGGCGGCGGCGGAGGAGGAGCUCUACUGAGCCGCAACUGUGGCGACAGCAACCGGAGUCGCAGCCGCCGCCACCUGCACCUGGCGCCUAGCCCACGUCCAGCGCCUGCCCGGCCGCCGCUUCCCGCCACCCUGCCCUGCCCACCCGCCAGGUACUACCAUUAAAGAUACCUUCUUCUCAGCAAAUCUAUGAUAAAAAAUAUAAGUAACAGAAGAAGAAAUAACUGUUAUUUGUCAAGUGACAAGCUUUUAAUGUCAGAAUGGCUCACCUAAAGCGACUAGUAAAAUUACACAUUAAAAGACAUUACCAUAAAAAGUUCUGGAAGCUUGGUGCAGUAAUUUUUUUCUUUAUAAUAGUUUUGGUUUUAAUGCAAAGAGAAGUAAGUGUUCAAUAUUCCAAAGAGGAAUCAAGGAUGGAAAGGAACAUGAAAAACAAAAACAAGAUGUUGGAUUUAAUGCUAGAAGCUGUAAACAAUAUUAAGGAUGCCAUGCCAAAAAUGCAAAUAGGAGCACCUGUCAGGCAAAACAUUGAUGCUGGUGAGAGACCUUGUUUGCAAGGAUAUUAUACAGCAGCAGAAUUGAAGCCUGUCCUUGACCGUCCACCUCAGGAUUCAAAUGCACCUGGUGCUUCUGGUAAAGCAUUCAAGACAACCAAUUUAAGUGUUGAAGAGCAAAAGGAAAAGGAACGUGGGGAAGCUAAACACUGCUUUAAUGCUUUCGCAAGUGACAGGAUUUCUUUGCACCGAGAUCUUGGACCAGACACUCGACCUCCUGAAUGUAUUGAACAAAAAUUUAAGCGCUGCCCUCCCCUGCCCACCACCAGUGUCAUAAUAGUUUUUCAUAAUGAAGCGUGGUCCACGUUGCUUAGAACUGUCCACAGUGUGCUCUAUUCUUCACCUGCAAUACUGCUGAAGGAAAUCAUUUUGGUGGAUGAUGCUAGUGUAGAUGAGUACUUACAUGAUAAACUAGAUGAAUAUGUAAAACAAUUUUCUAUAGUAAAAAUAGUCAGACAAAGAGAAAGAAAAGGUCUGAUCACUGCUCGGUUGCUAGGAGCAACAGUCGCAACAGCUGAAACGCUCACAUUUUUAGAUGCUCACUGUGAGUGUUUCUAUGGUUGGCUAGAACCUCUGUUGGCCAGAAUAGCUGAGAACUACACGGCUGUCGUAAGUCCAGAUAUUGCAUCCAUAGAUCUGAACACGUUUGAAUUCAACAAACCUUCUCCUUAUGGAAGUAACCAUAACCGUGGAAAUUUUGACUGGAGUCUUUCAUUUGGCUGGGAGUCGCUUCCUGAUCAUGAGAAGCAAAGAAGGAAAGAUGAAACCUACCCAAUUAAAACACCCACUUUUGCAGGAGGACUUUUUUCCAUAUCAAAAGAAUAUUUUGAGUAUAUUGGAAGCUAUGAUGAAGAAAUGGAAAUCUGGGGAGGUGAAAAUAUAGAAAUGUCUUUCAGAGUAUGGCAAUGUGGUGGGCAGUUGGAGAUUAUGCCUUGCUCUGUUGUUGGACAUGUUUUUCGCAGCAAAAGCCCUCAUAGCUUUCCAAAAGGCACUCAGGUGAUUGCUAGAAACCAAGUUCGCCUUGCAGAAGUCUGGAUGGAUGAAUACAAGGAAAUAUUUUAUAGGAGAAAUACAGAUGCAGCAAAAAUUGUUAAACAAAAAGCAUUUGGUGAUCUUUCAAAAAGAUUUGAAAUAAAACACCGCCUUCAGUGUAAAAAUUUUACAUGGUAUCUGAACAACAUUUAUCCAGAGGUGUAUGUGCCAGACCUUAAUCCUGUUAUAUCUGGAUACAUUAAAAGCGUUGGUCAGCCUCUAUGUCUGGAUGUUGGAGAAAACAAUCAAGGAGGCAAACCAUUAAUUAUGUAUACAUGUCAUGGACUUGGGGGAAACCAGUACUUUGAAUACUCUGCUCAACAUGAAAUUCGGCACAACAUCCAGAAGGAAUUAUGUCUUCAUGCUGCUCAAGGUCUCGUUCAGCUGAAGGCAUGUACCUACAAAGGUCACAAGACAGUUGUCACUGGAGAGCAGAUAUGGGAGAUCCAGAAGGAUCAACUUCUAUACAAUCCAUUCUUAAAAAUGUGCCUUUCAGCAAAUGGAGAGCAUCCAAGUUUAGUGUCAUGCAACCCAUCAGAUCCACUCCAAAAAUGGAUACUUAGCCAAAAUGAUUAAGUGUUCCUUAAAAUUAAGUUGAAAAAGGAAAUAUUCUUUCUCAUAAAACUGUGACUAGGCAUACACUGUAGUUUUUGAAAAUUAUGCAAAAGCAGCUAAAUGUAACUUAUUCCAAGUGCAUUUUUCUUAUUUAUAUCUUUAUGUAGCACUACUACAGAAAUUCUGCAAGUUUCUGUUUCAAAGCACAAUAACUAGUAAUACCAAAGACUAUUUCAAAAUGUCCAGAUGUAGGGGAAGAGAUGUUUACAGUAUGAUGAAAAUAAUUUUCCAAGUAAAGUGAUGUUUGUGUGUUUUGUACACUUAGGGAUAUAUAUAUAUAGCUACAUUCACACACUCACAAUUUAAAAUAUUUCCCCUAGUUUUUUGGGGGGAUAGGAAGAAAGAUUUGUUACUGUAUUUUUUUAACUACAUAAAAAUAGAUCAAUAAAUGUCAGCAUUGGCCUCUGUGUACAAACCAAGAGCUUUUACAGAUCCAGAAUUUAUUAGUUUAAAAUGCAGGUGAACUUUUUUUUGCGUUUGGUUUACUUGUCUGUCAAAUGUUUCCUUAAACAUGAAACUGAAUAAGGAGAAGAGUAUUUUUAACACUUAAAUUUCUUGGCAAAUUUUAAAACAUUUUUUAGUCUGUAAUACACUCCACUUGAAGCACUUAAGUCUUCCUUAAAUGACUUUUCUUAAGUAAUGAUACUGUGUGUUUUCCCAAAGCACUUUUAAAAAAAUUUUUAUAAAUUACUAUCUGUUGAAAAGGUGUCCUUUUCCUUUCUUCUAGUAUUUUUUUCUUACCAAAAUUCACUAAUCUUGAAUGUUUGUGAUAUUAAAUUUCAAAUGCAGAAUACUUGACUCAUUUAAAGCUAAAUUUUGUUACUGAUUCAAUUAUAAUUGUAAUGGAUUUUUGACUUUGUAAUGGAUUCUUUUCAUCAAAAAGCCUUAUUUUUUUAUCUAUGUGGAAAACACAAUAAAAAAUCCUCAACACUAUUGUAAUCAUUUGGUUAAGUUUUUUUCCUCUUUUGGGUAAAAUCUGUAAUUGAUAAUAGGUGGGGGAAAAUGAAUUUUGUAUGCUGAAUUUCUAAGCGCCUAUUGUUUGUAAAACCAUCAGAUAUUUCUUAUGGCACAAAAAAUGAGGAAUAGCAAAAUUCCUGUGUUCAAUAUUUAGAAAAUUUUGUAUUAAUUUCUGAUAAAGUUCCUUAAGCAUCUGA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 2591)
polypeptide N-acetylgalactosaminyltransferase 3
strand -
GalNAc-T3, HHS, HFTC
NCBI CDS gene sequence (1902 bp)
5'-ATGGCTCACCTAAAGCGACTAGTAAAATTACACATTAAAAGACATTACCATAAAAAGTTCTGGAAGCTTGGTGCAGTAATTTTTTTCTTTATAATAGTTTTGGTTTTAATGCAAAGAGAAGTAAGTGTTCAATATTCCAAAGAGGAATCAAGGATGGAAAGGAACATGAAAAACAAAAACAAGATGTTGGATTTAATGCTAGAAGCTGTAAACAATATTAAGGATGCCATGCCAAAAATGCAAATAGGAGCACCTGTCAGGCAAAACATTGATGCTGGTGAGAGACCTTGTTTGCAAGGATATTATACAGCAGCAGAATTGAAGCCTGTCCTTGACCGTCCACCTCAGGATTCAAATGCACCTGGTGCTTCTGGTAAAGCATTCAAGACAACCAATTTAAGTGTTGAAGAGCAAAAGGAAAAGGAACGTGGGGAAGCTAAACACTGCTTTAATGCTTTCGCAAGTGACAGGATTTCTTTGCACCGAGATCTTGGACCAGACACTCGACCTCCTGAATGTATTGAACAAAAATTTAAGCGCTGCCCTCCCCTGCCCACCACCAGTGTCATAATAGTTTTTCATAATGAAGCGTGGTCCACGTTGCTTAGAACTGTCCACAGTGTGCTCTATTCTTCACCTGCAATACTGCTGAAGGAAATCATTTTGGTGGATGATGCTAGTGTAGATGAGTACTTACATGATAAACTAGATGAATATGTAAAACAATTTTCTATAGTAAAAATAGTCAGACAAAGAGAAAGAAAAGGTCTGATCACTGCTCGGTTGCTAGGAGCAACAGTCGCAACAGCTGAAACGCTCACATTTTTAGATGCTCACTGTGAGTGTTTCTATGGTTGGCTAGAACCTCTGTTGGCCAGAATAGCTGAGAACTACACGGCTGTCGTAAGTCCAGATATTGCATCCATAGATCTGAACACGTTTGAATTCAACAAACCTTCTCCTTATGGAAGTAACCATAACCGTGGAAATTTTGACTGGAGTCTTTCATTTGGCTGGGAGTCGCTTCCTGATCATGAGAAGCAAAGAAGGAAAGATGAAACCTACCCAATTAAAACACCCACTTTTGCAGGAGGACTTTTTTCCATATCAAAAGAATATTTTGAGTATATTGGAAGCTATGATGAAGAAATGGAAATCTGGGGAGGTGAAAATATAGAAATGTCTTTCAGAGTATGGCAATGTGGTGGGCAGTTGGAGATTATGCCTTGCTCTGTTGTTGGACATGTTTTTCGCAGCAAAAGCCCTCATAGCTTTCCAAAAGGCACTCAGGTGATTGCTAGAAACCAAGTTCGCCTTGCAGAAGTCTGGATGGATGAATACAAGGAAATATTTTATAGGAGAAATACAGATGCAGCAAAAATTGTTAAACAAAAAGCATTTGGTGATCTTTCAAAAAGATTTGAAATAAAACACCGCCTTCAGTGTAAAAATTTTACATGGTATCTGAACAACATTTATCCAGAGGTGTATGTGCCAGACCTTAATCCTGTTATATCTGGATACATTAAAAGCGTTGGTCAGCCTCTATGTCTGGATGTTGGAGAAAACAATCAAGGAGGCAAACCATTAATTATGTATACATGTCATGGACTTGGGGGAAACCAGTACTTTGAATACTCTGCTCAACATGAAATTCGGCACAACATCCAGAAGGAATTATGTCTTCATGCTGCTCAAGGTCTCGTTCAGCTGAAGGCATGTACCTACAAAGGTCACAAGACAGTTGTCACTGGAGAGCAGATATGGGAGATCCAGAAGGATCAACTTCTATACAATCCATTCTTAAAAATGTGCCTTTCAGCAAATGGAGAGCATCCAAGTTTAGTGTCATGCAACCCATCAGATCCACTCCAAAAATGGATACTTAGCCAAAATGATTAA-3'
NCBI CDS gene sequence with introns (location: 165748781.. 165770700) (21920 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 165747588.. 165794247) (46660 bp)Download
NCBI gene sequence (location: [165747588.. 165794247 + 1000]) (47660 bp)Download
Cite How to cite