NCBI Summary
This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. [provided by RefSeq, Sep 2009].
Protein
Protein (NP_001092138)
SP-A2 / surfactant-associated protein A2
Pulmonary surfactant-associated protein A2 (PSP-A) (PSPA) (SP-A) (SP-A2) (35 kDa pulmonary surfactant-associated protein) (Alveolar proteinosis protein) (Collectin-5)
SFTPA2
surfactant protein A2
Undefined
Very low evidence
C-type lectin
SFTPA2
C-type - Collectins
a/b mixed / C-type lectin-like
MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
No structure currently available in the PDB RCSB Databank.
Structural models
SWISS-MODEL structural models
The location of the lectin domain structural model is: 115-248
We infer [0.86, 1.13] Å as the interval of error of this structural model.
Template 1: 4WRE chain: A, P08427, NP_001257574.1, sequence identity: 70.1%, coverage: 100.0%, location in sequence: 108-248, (88-228 in PDB).
Template 2: 6BBD chain: A, Q9N1X4, NP_999275.1, sequence identity: 40.3%, coverage: 100.0%, location in sequence: 225-378, (205-358 in PDB).
Template 3: 6LFJ chain: A, Q9D8Q7, NP_081494.1, sequence identity: 25.4%, coverage: 92.5%, location in sequence: 42-174, (75-207 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
We infer [0.86, 1.13] Å as the interval of error of this structural model.
Template 1: 4WRE chain: A, P08427, NP_001257574.1, sequence identity: 70.1%, coverage: 100.0%, location in sequence: 108-248, (88-228 in PDB).
Template 2: 6BBD chain: A, Q9N1X4, NP_999275.1, sequence identity: 40.3%, coverage: 100.0%, location in sequence: 225-378, (205-358 in PDB).
Template 3: 6LFJ chain: A, Q9D8Q7, NP_081494.1, sequence identity: 25.4%, coverage: 92.5%, location in sequence: 42-174, (75-207 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Oligomerization and Known Interactions
Oligomeric complex of 6 set of homotrimers
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
- Human Surfactant Protein SP-A1 and SP-A2 Variants Differentially Affect the Alveolar Microenvironment, Surfactant Structure, Regulation and Function of the Alveolar Macrophage, and Animal and Human Survival Under Various Conditions. [34484180]
- Identification of a Missense Mutation in the Surfactant Protein A2 Gene in a Chinese Family with Interstitial Lung Disease. [33181027]
- Functional assessment and phenotypic heterogeneity of SFTPA1 and SFTPA2 mutations in interstitial lung diseases and lung cancer. [32855221]
- Differences in the alveolar macrophage toponome in humanized SP-A1 and SP-A2 transgenic mice. [33141765]
- Identification and functional characterization of a novel surfactant protein A2 mutation (p.N207Y) in a Chinese family with idiopathic pulmonary fibrosis. [32602668]
- A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease. [16385451]
- Pulmonary Fibrosis, Familial [20301408]
- Characterization of a second human pulmonary surfactant-associated protein SP-A gene. [1372511]
- Studies of the structure of lung surfactant protein SP-A. [2610270]
- Isolation and characterization of cDNA clones for the 35-kDa pulmonary surfactant-associated protein. [3755136]
UniProt Main References (5 PubMed Identifiers)
- Human SP-A1 (SFTPA1) variant-specific 3' UTRs and poly(A) tail differentially affect the in vitro translation of a reporter gene. [20693318]
- The DNA sequence and comparative analysis of human chromosome 10. [15164054]
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
- Genetics of the hydrophilic surfactant proteins A and D. [9813381]
- Genetic defects in surfactant protein A2 are associated with pulmonary fibrosis and lung cancer. [19100526]
All isoforms of this gene containing a lectin domain
RNA
RNA (Transcript ID: NM_001098668.4)
surfactant protein A2, transcript variant 1
m7G-5')ppp(5'-AACUUGGAGGCAGAGACCCAAGCAGCUGGAGGCUCUGUGUGUGGGUCGCUGAUUUCUUGGAGCCUGAAAAGAAGGAGCAGCGACUGGACCCAGAGCCAUGUGGCUGUGCCCUCUGGCCCUCACCCUCAUCUUGAUGGCAGCCUCUGGUGCUGCGUGCGAAGUGAAGGACGUUUGUGUUGGAAGCCCUGGUAUCCCCGGCACUCCUGGAUCCCACGGCCUGCCAGGCAGGGACGGGAGAGAUGGUGUCAAAGGAGACCCUGGCCCUCCAGGCCCCAUGGGUCCGCCUGGAGAAACACCAUGUCCUCCUGGGAAUAAUGGGCUGCCUGGAGCCCCUGGUGUCCCUGGAGAGCGUGGAGAGAAGGGGGAGGCUGGCGAGAGAGGCCCUCCAGGGCUUCCAGCUCAUCUAGAUGAGGAGCUCCAAGCCACACUCCACGACUUCAGACAUCAAAUCCUGCAGACAAGGGGAGCCCUCAGUCUGCAGGGCUCCAUAAUGACAGUAGGAGAGAAGGUCUUCUCCAGCAAUGGGCAGUCCAUCACUUUUGAUGCCAUUCAGGAGGCAUGUGCCAGAGCAGGCGGCCGCAUUGCUGUCCCAAGGAAUCCAGAGGAAAAUGAGGCCAUUGCAAGCUUCGUGAAGAAGUACAACACAUAUGCCUAUGUAGGCCUGACUGAGGGUCCCAGCCCUGGAGACUUCCGCUACUCAGAUGGGACCCCUGUAAACUACACCAACUGGUACCGAGGGGAGCCUGCAGGUCGGGGAAAAGAGCAGUGUGUGGAGAUGUACACAGAUGGGCAGUGGAAUGACAGGAACUGCCUGUACUCCCGACUGACCAUCUGUGAGUUCUGAGAGGCAUUUAGGCCAUGGGACAGGGAGGAUCCUGUCUGGCCUUCAGUUUCCAUCCCCAGGAUCCACUUGGUCUGUGAGAUGCUAGAACUCCCUUUCAACAGAAUUCACUUGUGGCUAUUAGAGCUGGAGGCACCCUUAGCCACUUCAUUCCCCUGAUGGGCCCUGACUCUUCCCCAUAAUCACUGACCAGCCUUGACACUCCCCUUGCAAACCAUCCCAGCACUGCACCCCAGGCAGCCACUCCUAGCCUUGGCCUUUGGCAUGAGAUGGAGGCCUCCUUAUUCCCCAUCUGGUCCAGUUCCUUCACUUACAGAUGGCAGCAGUGAGGCCUUGGGGUAGAAGGAUCCUCCAAAGUCACACAGAGUGCCUGCCUCCUGGUCCCCUCAGCUCUGCCUCUGCAGCCCACUGCCUGCCCAGUGCCAUCAGGAUGAGCAGUACCGGCCAAGCAUAAUGACAGAGAGAGGCAGAUUUCAGGGAAGCCCUGACUGUGUGGAGCUAAGGACACAGUGGAGAUUCUCUGGCACUCUGAGGUCUCUGUGGCAGGCCUGGUCAGGCUCUCCAGGUGGUCAGAGGGCCCAGUGGUGCCCCAGCACGGUGGUGCCCAAGCCAACCCUGUGACUGACAUGUACGAUUCACUCCUUUGAGUCUUUGGAUGCCAACUCAGCCCCCUGACCUGGAGGCAGCCGGCCAAGGCCUCUAGGGAAGAGCCCCCCACUGCAGACAUGACCCGAGUAACUUUCUGCUGAUGAACAAAUCUGCACCCCACUUCAGACCUCGGUGGGCAUUCACACCACCCCCCAUGCCACCGGCUCCACUUUCCCCUUUUAUUAAUACAUUCACCCAGAUAAUCAUUAAAAUUAACAUGUGCCAGGUCUUAGGAUGUGUCUUGGGGUGGGCACAGUACCCGGUGACUCUUGGGGAUAUUUAUUUAUUUUCCCUGAGCCUAUAUCUUCAUCUGUGAAAUGGGGAUAAAAAUACUUGUUGCUGUCACAAUUAUUACCAUCUCUCCAGCUAGCAAAAUUACUACCAGAGCCGUUACUACACACAAAGGCUAUUGACCGAGCACAUACCAUGUGCCACACACCUUGACAAAAUCUUUUAAUACAGUUUAUUAUGUACUAUUCAAUCUUUACACAAUGUCACGGGACCAGUAUUGUUUACCCAAUUUUUUAUAAGGACACUGAAGCUUAGAGGAGUGAAAUGUUUUGAGUGUUAUUUCAGAGAGCAAAUGGCAAAGACUGGAUCCAAACCCAUCUUCCUGGACCUGAAGUUCAUGCUCCCAGCCACCCCACCCCUGAGCUGAAUAAAGAUGAUUUAAGCAUAAUAAAUCGUUAGUGUGUUCACAUGAGUUUCCAUA-3'- Poly-A tail - Coding region
DNA
DNA (Gene ID: 729238)
surfactant protein A2
strand -
NCBI CDS gene sequence (747 bp)
5'-ATGTGGCTGTGCCCTCTGGCCCTCACCCTCATCTTGATGGCAGCCTCTGGTGCTGCGTGCGAAGTGAAGGACGTTTGTGTTGGAAGCCCTGGTATCCCCGGCACTCCTGGATCCCACGGCCTGCCAGGCAGGGACGGGAGAGATGGTGTCAAAGGAGACCCTGGCCCTCCAGGCCCCATGGGTCCGCCTGGAGAAACACCATGTCCTCCTGGGAATAATGGGCTGCCTGGAGCCCCTGGTGTCCCTGGAGAGCGTGGAGAGAAGGGGGAGGCTGGCGAGAGAGGCCCTCCAGGGCTTCCAGCTCATCTAGATGAGGAGCTCCAAGCCACACTCCACGACTTCAGACATCAAATCCTGCAGACAAGGGGAGCCCTCAGTCTGCAGGGCTCCATAATGACAGTAGGAGAGAAGGTCTTCTCCAGCAATGGGCAGTCCATCACTTTTGATGCCATTCAGGAGGCATGTGCCAGAGCAGGCGGCCGCATTGCTGTCCCAAGGAATCCAGAGGAAAATGAGGCCATTGCAAGCTTCGTGAAGAAGTACAACACATATGCCTATGTAGGCCTGACTGAGGGTCCCAGCCCTGGAGACTTCCGCTACTCAGATGGGACCCCTGTAAACTACACCAACTGGTACCGAGGGGAGCCTGCAGGTCGGGGAAAAGAGCAGTGTGTGGAGATGTACACAGATGGGCAGTGGAATGACAGGAACTGCCTGTACTCCCGACTGACCATCTGTGAGTTCTGA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.
How to cite
