NCBI Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_060908)
F-box protein 6
F-box only protein 6 (F-box protein that recognizes sugar chains 2) (F-box/G-domain protein 2)
FBXO6
F-box protein 6
Undefined
Low evidence
F-box
F-Box Lectins
b-sandwich / Galactose-binding domain-like
High mannose glycans
Undefined
Protein sequence and protein families (fasta) (293 amino acids) Download
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

SWISS-MODEL structural models
Oligomerization and Known Interactions
Interacts with VCP (By similarity). Part of a SCF (SKP1-cullin-F-box) protein ligase complex. Interacts with CHEK1 and CUL1. Source: UniProt
Annotation
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
Expression
Functionality temporarily unavailable.
References
NCBI References (10 PubMed Identifiers)
  • FBXO6-mediated RNASET2 ubiquitination and degradation governs the development of ovarian cancer. [33767133]
  • A reference map of the human binary protein interactome. [32296183]
  • Noncanonical Role of FBXO6 in Regulating Antiviral Immunity. [31308089]
  • Fbxo6 confers drug-sensitization to cisplatin via inhibiting the activation of Chk1 in non-small cell lung cancer. [31140586]
  • A protein-interaction network of interferon-stimulated genes extends the innate immune system landscape. [30833792]
  • Fbs2 is a new member of the E3 ubiquitin ligase family that recognizes sugar chains. [12939278]
  • A new subfamily of structurally related human F-box proteins. [12383498]
  • cDNA cloning and expression analysis of new members of the mammalian F-box protein family. [10945468]
  • A family of mammalian F-box proteins. [10531037]
  • Identification of a family of human F-box proteins. [10531035]
UniProt Main References (7 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Diversity in tissue expression, substrate binding, and SCF complex formation for a lectin family of ubiquitin ligases. [18203720]
  • The F box protein Fbx6 regulates Chk1 stability and cellular sensitivity to replication stress. [19716789]
  • Initial characterization of the human central proteome. [21269460]
  • Toward a comprehensive characterization of a human cancer cell phosphoproteome. [23186163]
RNA
RNA (Transcript ID: NM_018438.6)
F-box protein 6
m7G-5')ppp(5'-GAGACAGCUUCAGGACACGCAGGCCGCAGCGAGGGCCCGGGCCCUGGGGAUCCCAGGCCAUGGAUGCUCCCCACUCCAAAGCAGCCCUGGACAGCAUUAACGAGCUGCCCGAGAACAUCCUGCUGGAGCUGUUCACGCACGUGCCCGCCCGCCAGCUGCUGCUGAACUGCCGCCUGGUCUGCAGCCUCUGGCGGGACCUCAUCGACCUCAUGACCCUCUGGAAACGCAAGUGCCUGCGAGAGGGCUUCAUCACCAAGGACUGGGACCAGCCCGUGGCCGACUGGAAAAUCUUCUACUUCCUACGGAGCCUGCAUAGGAACCUCCUGCGCAACCCGUGUGCUGAAGAGGAUAUGUUUGCAUGGCAAAUUGAUUUCAAUGGUGGGGACCGCUGGAAGGUGGAGAGCCUCCCUGGAGCCCACGGGACAGAUUUUCCUGACCCCAAAGUCAAGAAGUAUUUUGUCACAUCCUACGAAAUGUGCCUCAAGUCCCAGCUGGUGGACCUUGUAGCCGAGGGCUACUGGGAGGAGCUACUAGACACAUUCCGGCCGGACAUCGUGGUUAAGGACUGGUUUGCUGCCAGAGCCGACUGUGGCUGCACCUACCAACUCAAAGUGCAGCUGGCCUCGGCUGACUACUUCGUGUUGGCCUCCUUCGAGCCCCCACCUGUGACCAUCCAACAGUGGAACAAUGCCACAUGGACAGAGGUCUCCUACACCUUCUCAGACUACCCCCGGGGUGUCCGCUACAUCCUCUUCCAGCAUGGGGGCAGGGACACCCAGUACUGGGCAGGCUGGUAUGGGCCCCGAGUCACCAACAGCAGCAUUGUCGUCAGCCCCAAGAUGACCAGGAACCAGGCCUCCUCCGAGGCUCAGCCUGGGCAGAAGCAUGGACAGGAGGAGGCUGCCCAAUCGCCCUACCGAGCUGUUGUCCAGAUUUUCUGACAGCUGUCCAUCCUGUGUCUGGGUCAGCCAGAGGUUCCUCCAGGCAGGAGCUGAGCAUGGGGUGGGCAGUGAGGUCCCUGUACCAGCGACUCCUGCCCCGGUUCAACCCUACCAGCUUGUGGUAACUUACUGUCACAUAGCUCUGACGUUUUGUUGUAAUAAAUGUUUUCAGGCCGGGCACUGUGGCUCACGCCUGUAAUCCCAGCACUUUGGGAGACCGAGGCAGGUGGAUCACGAGGUCAGGAGAUAGAGACCAUCCUGGCCAACACGGUGAAACCCUGUCUCUACUAAAAAUACAAAAAAUUAGCCGGGCGUGGUGGCGGGCGCCUGUAGUCCCAGCUACUCGGGAGGCUGAUGCAGAAGAAUGGCGUGAACCCGGAAGGCAGAGCUUGCAGUGAGCCGAGAUCACGCCACUGCACUCCAGCCUGGGUGACAGAGCGAGACUCUGGCUCAUAAAAUAAUAAUAAUAAUAAAUAAAUAAAAAAUAAAUGUUUUCAGUAAAA-3'- Poly-A tail
  • Coding region
DNA
DNA (Gene ID: 26270)
F-box protein 6
strand +
FBX6, FBG2, FBS2, Fbx6b
NCBI CDS gene sequence (882 bp)
5'-ATGGATGCTCCCCACTCCAAAGCAGCCCTGGACAGCATTAACGAGCTGCCCGAGAACATCCTGCTGGAGCTGTTCACGCACGTGCCCGCCCGCCAGCTGCTGCTGAACTGCCGCCTGGTCTGCAGCCTCTGGCGGGACCTCATCGACCTCATGACCCTCTGGAAACGCAAGTGCCTGCGAGAGGGCTTCATCACCAAGGACTGGGACCAGCCCGTGGCCGACTGGAAAATCTTCTACTTCCTACGGAGCCTGCATAGGAACCTCCTGCGCAACCCGTGTGCTGAAGAGGATATGTTTGCATGGCAAATTGATTTCAATGGTGGGGACCGCTGGAAGGTGGAGAGCCTCCCTGGAGCCCACGGGACAGATTTTCCTGACCCCAAAGTCAAGAAGTATTTTGTCACATCCTACGAAATGTGCCTCAAGTCCCAGCTGGTGGACCTTGTAGCCGAGGGCTACTGGGAGGAGCTACTAGACACATTCCGGCCGGACATCGTGGTTAAGGACTGGTTTGCTGCCAGAGCCGACTGTGGCTGCACCTACCAACTCAAAGTGCAGCTGGCCTCGGCTGACTACTTCGTGTTGGCCTCCTTCGAGCCCCCACCTGTGACCATCCAACAGTGGAACAATGCCACATGGACAGAGGTCTCCTACACCTTCTCAGACTACCCCCGGGGTGTCCGCTACATCCTCTTCCAGCATGGGGGCAGGGACACCCAGTACTGGGCAGGCTGGTATGGGCCCCGAGTCACCAACAGCAGCATTGTCGTCAGCCCCAAGATGACCAGGAACCAGGCCTCCTCCGAGGCTCAGCCTGGGCAGAAGCATGGACAGGAGGAGGCTGCCCAATCGCCCTACCGAGCTGTTGTCCAGATTTTCTGA-3'
NCBI CDS gene sequence with introns (location: 11668659.. 11673851) (5193 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 11664200.. 11674354) (10155 bp)Download
NCBI gene sequence (location: [11664200 - 1000].. 11674354) (11155 bp)Download
Cite How to cite