NCBI Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_036300)
F-box protein 2
F-box only protein 2 (FBG1) (Fbs1)
FBXO2
F-box protein 2
Undefined
Curated
F-box associated domain
F-Box Lectins
b-sandwich / Galactose-binding domain-like
Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
Undefined
Protein sequence and protein families (fasta) (296 amino acids) Download
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Fbxo2 mediates clearance of damaged lysosomes and modifies neurodegeneration in the Niemann-Pick C brain. [32931479]
  • A reference map of the human binary protein interactome. [32296183]
  • FBXO2, a novel marker for metastasis in human gastric cancer. [29269301]
  • Genetic Analysis of FBXO2, FBXO6, FBXO12, and FBXO41 Variants in Han Chinese Patients with Sporadic Parkinson's Disease. [28341977]
  • An engineered high affinity Fbs1 carbohydrate binding protein for selective capture of N-glycans and N-glycopeptides. [28534482]
  • E3 ubiquitin ligase that recognizes sugar chains. [12140560]
  • A family of mammalian F-box proteins. [10531037]
  • Identification of a family of human F-box proteins. [10531035]
  • A novel F box protein, NFB42, is highly enriched in neurons and induces growth arrest. [9857061]
  • Organ of Corti-specific polypeptides: OCP-I and OCP-II. [7458746]
UniProt Main References (4 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The DNA sequence and biological annotation of human chromosome 1. [16710414]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Initial characterization of the human central proteome. [21269460]
RNA
RNA (Transcript ID: NM_012168.6)
F-box protein 2
m7G-5')ppp(5'-AGACGCGGACAGCGCCGGGACUCGCCGCCCCGGGACUCGCGCAGCCCGCAGCGCUCCGGCUCCUCCUCUCGCGACCGCCCUCCGCAGCGAUGGACGGAGACGGUGACCCAGAGAGCGUGGGCCAGCCCGAGGAGGCAAGCCCGGAGGAGCAGCCAGAGGAGGCGAGUGCUGAGGAGGAGCGGCCGGAGGACCAGCAGGAGGAGGAGGCGGCGGCCGCCGCCGCGUACCUGGACGAGCUGCCCGAGCCGCUGCUGCUGCGCGUGCUGGCCGCACUGCCGGCCGCCGAGCUGGUGCAGGCCUGCCGCCUGGUGUGCCUGCGCUGGAAGGAGCUGGUGGACGGCGCCCCGCUGUGGCUGCUCAAGUGCCAGCAGGAGGGGCUGGUGCCCGAGGGCGGCGUGGAGGAGGAGCGCGACCACUGGCAGCAGUUCUACUUCCUGAGCAAGCGGCGCCGCAACCUUCUGCGUAACCCGUGUGGGGAAGAGGACUUGGAAGGCUGGUGUGACGUGGAGCAUGGUGGGGACGGCUGGAGGGUGGAGGAGCUGCCUGGAGACAGUGGGGUGGAGUUCACCCACGAUGAGAGCGUCAAGAAGUACUUCGCCUCCUCCUUUGAGUGGUGUCGCAAAGCACAGGUCAUUGACCUGCAGGCUGAGGGCUACUGGGAGGAGCUGCUGGACACGACUCAGCCGGCCAUCGUGGUGAAGGACUGGUACUCGGGCCGCAGCGACGCUGGUUGCCUCUACGAGCUCACCGUUAAGCUACUGUCCGAGCACGAGAACGUGCUGGCUGAGUUCAGCAGCGGGCAGGUGGCAGUGCCCCAAGACAGUGACGGCGGGGGCUGGAUGGAGAUCUCCCACACCUUCACCGACUACGGGCCGGGCGUCCGCUUCGUCCGCUUCGAGCACGGGGGGCAGGACUCCGUCUACUGGAAGGGCUGGUUCGGGGCCCGGGUGACCAACAGCAGCGUGUGGGUAGAACCCUGAGCGACCCUGCCUCCACUCUCCCCCAGCUGCCUGGAGGGGCAAAGGUCGAGGGUAGAUAGGCCUUAACUUAGUCCAUAGCGUCCUCACCUUCCCCAAGCCACACAUCCUCCUCCCAUCCCUUGCUCCGAUCCCAGCCCCUGAGCAGGGAGAGAGAAGUUUUGUUGGCAUAGGUUUGCUUAGGUAGCCGGCUUCUAGAAUGUAGAUCCGUGAGGGCGUGAGCUUGGACUGGACCCACUGCUGAUUCCCUGCACCUAGCACAGUGCUUGCCACAAAGUGGGCUCUCAAUAAAUAUUAUUUGUCCAAGGAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 26232)
F-box protein 2
strand -
FBX2, Nfb42, Fbs1, Fbg1
NCBI CDS gene sequence (891 bp)
5'-ATGGACGGAGACGGTGACCCAGAGAGCGTGGGCCAGCCCGAGGAGGCAAGCCCGGAGGAGCAGCCAGAGGAGGCGAGTGCTGAGGAGGAGCGGCCGGAGGACCAGCAGGAGGAGGAGGCGGCGGCCGCCGCCGCGTACCTGGACGAGCTGCCCGAGCCGCTGCTGCTGCGCGTGCTGGCCGCACTGCCGGCCGCCGAGCTGGTGCAGGCCTGCCGCCTGGTGTGCCTGCGCTGGAAGGAGCTGGTGGACGGCGCCCCGCTGTGGCTGCTCAAGTGCCAGCAGGAGGGGCTGGTGCCCGAGGGCGGCGTGGAGGAGGAGCGCGACCACTGGCAGCAGTTCTACTTCCTGAGCAAGCGGCGCCGCAACCTTCTGCGTAACCCGTGTGGGGAAGAGGACTTGGAAGGCTGGTGTGACGTGGAGCATGGTGGGGACGGCTGGAGGGTGGAGGAGCTGCCTGGAGACAGTGGGGTGGAGTTCACCCACGATGAGAGCGTCAAGAAGTACTTCGCCTCCTCCTTTGAGTGGTGTCGCAAAGCACAGGTCATTGACCTGCAGGCTGAGGGCTACTGGGAGGAGCTGCTGGACACGACTCAGCCGGCCATCGTGGTGAAGGACTGGTACTCGGGCCGCAGCGACGCTGGTTGCCTCTACGAGCTCACCGTTAAGCTACTGTCCGAGCACGAGAACGTGCTGGCTGAGTTCAGCAGCGGGCAGGTGGCAGTGCCCCAAGACAGTGACGGCGGGGGCTGGATGGAGATCTCCCACACCTTCACCGACTACGGGCCGGGCGTCCGCTTCGTCCGCTTCGAGCACGGGGGGCAGGACTCCGTCTACTGGAAGGGCTGGTTCGGGGCCCGGGTGACCAACAGCAGCGTGTGGGTAGAACCCTGA-3'
NCBI CDS gene sequence with introns (location: 11648694.. 11654340) (5647 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 11648387.. 11654429) (6043 bp)Download
NCBI gene sequence (location: [11648387.. 11654429 + 1000]) (7043 bp)Download
Cite How to cite