NCBI Summary
This gene encodes a member of the GalNAc polypeptide N-acetylgalactosaminyltransferases. These enzymes catalyze the first step in the synthesis of mucin-type oligosaccharides. These proteins transfer GalNAc from UDP-GalNAc to either serine or threonine residues of polypeptide acceptors. The protein encoded by this locus may have increased catalytic activity toward glycosylated peptides compared to activity toward non-glycosylated peptides.[provided by RefSeq, Apr 2010].
Protein
Protein (NP_938080)
CBM13-ppGalNAc-T10
Polypeptide N-acetylgalactosaminyltransferase 10 (EC 2.4.1.41) (Polypeptide GalNAc transferase 10) (GalNAc-T10) (pp-GaNTase 10) (Protein-UDP acetylgalactosaminyltransferase 10) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10)
GALNT10
polypeptide N-acetylgalactosaminyltransferase 10
Undefined
Curated
Ricin-like
R-Type Lectins
b-trefoil
Undefined
Protein sequence and protein families (fasta) (603 amino acids) Download
MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


Ligand
Glycan ligands from structural data
Tn Antigen
GalNAc
References
NCBI References (10 PubMed Identifiers)
  • GALNT10 promotes the proliferation and metastatic ability of gastric cancer and reduces 5-fluorouracil sensitivity by activating HOXD13. [33275228]
  • Elevated GALNT10 expression identifies immunosuppressive microenvironment and dismal prognosis of patients with high grade serous ovarian cancer. [31853576]
  • Prognostic role of N-Acetylgalactosaminyltransferase 10 in metastatic renal cell carcinoma. [28122358]
  • Genetic variants in LEKR1 and GALNT10 modulate sex-difference in carotid intima-media thickness: a genome-wide interaction study. [25898001]
  • Decreased expression of hepatocyte nuclear factor 4alpha (Hnf4alpha)/microRNA-122 (miR-122) axis in hepatitis B virus-associated hepatocellular carcinoma enhances potential oncogenic GALNT10 protein activity. [25422324]
  • A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry. [23583978]
  • Genome-wide association of BMI in African Americans. [21701570]
  • Glycopeptide-preferring polypeptide GalNAc transferase 10 (ppGalNAc T10), involved in mucin-type O-glycosylation, has a unique GalNAc-O-Ser/Thr-binding site in its catalytic domain not found in ppGalNAc T1 or T2. [19460755]
  • The catalytic and lectin domains of UDP-GalNAc:polypeptide alpha-N-Acetylgalactosaminyltransferase function in concert to direct glycosylation site selection. [18562306]
  • Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T10. [12417297]
UniProt Main References (5 PubMed Identifiers)
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • The full-ORF clone resource of the German cDNA Consortium. [17974005]
  • Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. [12693554]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10). [16650853]
RNA
RNA (Transcript ID: NM_198321.4)
polypeptide N-acetylgalactosaminyltransferase 10
m7G-5')ppp(5'-GAGUUGGAGCGGGGCCGGCGCCGCAGCCGCUUCUGCUGGCUGAGCUGCUGCCGCCGCCGGGCGGACGGGCGGACGCGCGGAGCUGGGGGCGGCGCGGCGGGGCCGGCGGGGCGCGGCGGGGCUGACCGGCCCCGAUGAGGCGGAAGGAGAAGCGGCUCCUGCAGGCGGUGGCGCUGGUGCUGGCGGCCCUGGUCCUCCUGCCCAACGUGGGGCUUUGGGCGCUGUACCGCGAGCGGCAGCCCGACGGCACCCCUGGGGGAUCGGGGGCGGCGGUGGCGCCGGCGGCGGGACAGGGCUCACACAGUCGACAAAAGAAAACGUUUUUCUUGGGAGAUGGGCAGAAGCUGAAGGACUGGCAUGACAAGGAGGCCAUCCGGAGGGACGCUCAGCGCGUAGGAAAUGGAGAACAAGGAAGACCUUACCCCAUGACCGAUGCUGAGAGAGUGGAUCAGGCAUACCGAGAAAAUGGAUUUAACAUCUACGUCAGUGAUAAAAUCUCCUUGAAUCGCUCUCUCCCAGAUAUCCGGCACCCAAACUGCAACAGCAAGCGCUACCUGGAGACACUUCCCAACACAAGCAUCAUCAUCCCCUUCCACAACGAGGGCUGGUCCUCCCUCCUCCGCACCGUCCACAGUGUGCUCAAUCGCUCGCCUCCAGAGCUGGUCGCCGAGAUUGUACUGGUCGACGACUUCAGUGAUCGAGAGCACCUGAAGAAGCCUCUUGAAGACUACAUGGCCCUUUUCCCCAGUGUGAGGAUUCUUCGAACCAAGAAACGGGAAGGGCUGAUAAGGACCCGAAUGCUGGGGGCCUCAGUGGCAACUGGGGAUGUCAUCACAUUCUUGGAUUCACACUGUGAAGCCAAUGUCAACUGGCUUCCCCCCUUGCUUGACCGCAUUGCUCGGAACCGCAAGACCAUUGUGUGCCCGAUGAUUGAUGUAAUUGACCAUGACGACUUUCGGUACGAGACACAGGCAGGGGAUGCCAUGCGGGGAGCCUUUGACUGGGAGAUGUACUACAAGCGGAUCCCGAUCCCUCCAGAACUGCAGAAAGCUGACCCCAGCGACCCAUUUGAGUCUCCCGUGAUGGCCGGUGGACUGUUCGCCGUGGAUCGGAAGUGGUUCUGGGAACUCGGCGGGUAUGACCCAGGCUUGGAGAUCUGGGGAGGGGAGCAGUAUGAAAUCUCCUUCAAGGUGUGGAUGUGUGGGGGCCGCAUGGAGGACAUCCCCUGCUCCAGGGUGGGCCAUAUCUACAGGAAGUAUGUGCCCUACAAGGUCCCGGCCGGAGUCAGCCUGGCCCGGAACCUUAAGCGGGUGGCCGAAGUGUGGAUGGAUGAGUACGCAGAGUACAUUUACCAGCGCCGGCCUGAAUACCGCCACCUCUCCGCUGGGGAUGUCGCAGUCCAGAAAAAGCUCCGCAGCUCCCUUAACUGCAAGAGUUUCAAGUGGUUUAUGACGAAGAUAGCCUGGGACCUGCCCAAAUUCUACCCACCCGUGGAGCCCCCGGCUGCAGCUUGGGGGGAGAUCCGAAAUGUGGGCACAGGGCUGUGUGCAGACACAAAGCACGGGGCCUUGGGCUCCCCACUAAGGCUAGAGGGCUGCGUCCGAGGCCGUGGGGAGGCUGCCUGGAACAACAUGCAGGUAUUCACCUUCACCUGGAGAGAGGACAUCCGGCCUGGAGACCCCCAGCACACCAAGAAGUUCUGCUUUGAUGCCAUUUCCCACACCAGCCCUGUCACGCUGUACGACUGCCACAGCAUGAAGGGCAACCAGCUGUGGAAAUACCGCAAAGACAAGACCCUGUACCACCCUGUCAGUGGCAGCUGCAUGGACUGCAGUGAAAGUGACCAUAGGAUCUUCAUGAACACCUGCAACCCAUCCUCUCUCACCCAGCAGUGGCUGUUUGAACACACCAACUCAACAGUCUUGGAAAAAUUCAAUAGGAACUGAGCCCUCAUGUCCCCUUGGCAGGCCCCCCAGGGUCUGGCACUCACUGCAGACUUCCUCUUUCAAGGGAGGCAGGGCCCCUGUGGGCACUAGGUGUAAAAGGUGCUGGCCAAAUGGUUCAGGGUGAAGAGGGCUCUUGAUUCAGGGGCUGGGGUCUGCCUGGUCCUUGAGCCCCUGAGUUGUGGGGGUAGGGUGAAGAGCAUAUCCCACAAGAGGCCCCACAGGGAGCAGAGACUGCUUUAAUCCCUGCUGACAUCACGGAAAAGCAACAGAGCCUUUUCAACUUUGUCACUAUGUCCCCUUGAACAUUAUGUGGGAGAACACCAAGGUAGCCUAGGCCACCCAAAAGUGAGUCCUGCGAGGUUGCCCAGCCCUCAGAUGGCUCUCCUACAUGAUGGUGCUUUAGAAACAAAGGUAAAAUUUGCCUGUUUGGGGCAGCUUUUAGUAUCGAUGCCACUCAUCUGCAGCAGAAGAGAAAGAAGUCCUCUUGGGGCUUUUUAGUUUCUGCCGUCCUGGGGGGAACAUUGCAGUUACUGCACAGCUUCUGUUCUCUGUCACAACCCCAGGUGAUUUGGUCCGGUCAAAGGCCAUACUUGGGGCCCUAAGAGUGUUCAGUAUUGAAUGCUGAUCAGCUGCCAGGUGAGGAGUCAGAAGAGGGAGCCCCCCUAGACAUUUCUUUGCAGCUAUGGACAUGCGGGAUAUCUCCCCCUGCUCUCUGGGUAUUUGAAAUGUCAAUUUUAGCACUCUCCAGGCACAAGGACAGCCCAGCACCAGCUUUACAGGGCAGUGUUUCAGAUGGCCCUGAGCCCACGGAAAAGGCCAGGUAGACCUCCAAACUAGAAAUGCUGGCUGAUUUGCCCUGAUCCAUGCUUCCAUUUCCCUGUCUCUCUUCCCCAGGCAAUUACUGGCCUCAAAAGAGGAACAGAGGUGCUGCGAGGUGCUCACCUCACAGAGUCUGGAGGCCUCCAGGAUCAACUGUGGGCAAAGUGCCUGCCUCUGACCUCAUCAUGGUUCUAGUUCUCAUACAGAACUCCAGAAUUUUUAAAGAACUCUAUAAUUGGAUUGCAAACUAGGAUGCUACAUAGGAUUCUGGUAUUCCACAUCCAAUAUGGAUUUCUAGAAUGCUGUGAUUAAAGGAGCCAGCCAGGUGUAAUACAGUCAAGGCAGCCCCCAGCCUAGAGACAAUCUGUGAAAUCCAAAGUUGGUGGUGUUGGGAAAGCAGGGGGACAUGUGUCCCUCAGCUCAGCAGAGGCUGUGGUACAACAUGGUCCUUGGUGAAGACCUGCACCCCUGGAACCUCCCACCAUCAUCACAACUGUAGUCUCAUUUGCAGUGGAGAAAAGAACCCGACGUCCCACAGCCAGAUAUACACCCAGCUCCAUGCCAGCCCUUCAUGUUUACCUUUUGCUUUGUUAAUUACAUGUCAGACUCCUAGAGGGCCUCCAGACUAAUAGGAAGCAUUUCUGUAACCAACCUGCCACCCACUGAUUCAGAAAUGGAAAUCACAUUCCACAAUCUAUGGCUUCCACCAGCUAGCCCAGGAAAUACUUGAAAUCAGCAUUCCAAUUAGUGUUGAGUCUCUUGAUUGUGUCAUUUACCAAUUAAAUAACUGAGACCUAAGUCUGGGAACAGAGCCACGAAUCUGCCUUUGAGAUGCUGGCAGAUCUCAAGGCCAUCAAUUAUUGGGGGAGGGAGGGACAAACACUCCCAAUCAUCCACCAGUCAGACUGAAUGUGUAGCUGGCGAGGAAUUACUUCCACUUCUGGCCCAGCACAAGCCCUGCUUUGGCCACCUGUCUGCAAGAGAGGCGGCCCCUGUGCUUGCAACGCUUACGUGUUGAUCCCAGUGUCCUUUUCCAAAUGAGUGCUGUAGCUUUAGAAGUGGCCCUCUAUAGAAAGAAGUCAAAAGAUGAGGCCCCUUCUAGAAUCUAGGAUAACAAGAGUGUUGACAGUUUGAGGAGUCGAAUUGAGAUUCAUCAUCAAAGAGCAAUGCAGCGUCGUUAAAAUAAAAACUGUGCCUUUUAAAAAGAAAAAUGCAAAUAUAGAGCAAAUCCCUAAACUUGAACCAUUUCCUAGUGCCUUGCUAGACAAACAUAAAGGGGCAGGGUUGUGGGGAGGGGAACGUUUUUGGUGGUGUGUGCAGUUCCUACUGGAUGAGUGUGUGUUUCUUAAUGUCUCAUUUCAAGCAGGAGAUGUUGGGUCUGGAGCAAGAUCUGAGACUGAGAUGUCCCCCAAGGGUGACAGGUCAGAUUUAUUUCAGUCAGUGCAAGUCACACUCCAAACUAAAGGCUGGGCAGUGCGUUUAGUCUGUGGCCUAGAAGACCUCAUCAGCCCCCGAGAGGAGGCCUUGCAUUACCUCACUGGGACCUGUUUGGGGGCCAUCCCUGCGGUCCACCCUCUGAACCCCCAGCAUGUUUGUCCUGUUUCUCACCAUUGGGUUAAGGGGUGCCGAGCACUAGCUAGACUUCCACAUAGUCCCACCCCAAGUGGGCGGCAGUGUUCCUGGCAUGACCAGGAUUCCUGUGAAAGCAGGAGCAGCAGCAAGCCGUCCCGGGCCUGCCUUUCCCAUCCUUUGGUUCUCCUUUCCAGUCUGGGUUCACACCCUGAAAAGGGAUGGGUGUGUCCUCUGAGCACUCUGGCAUUUGUCAUUGCUGAGCCCAUAUCAGUAGGUCCUGGGACUUGACAAAGUAUGUGGGAGGGGAAGGAAGGACAGAACUUGACUGGCUCCAUUUCAUGGACCAACUGAUCAAUUGCCAGUACUAAGCCACUCAUUGUUAUGGCUUCCUUUUUGAAAACCACCUGUCUCAAGGAUUCAGGUUUCUGCUCACAUCCCCAGCUGAUGCUCAAUAAAACUCAGCCAGGAGCAUAUGGAGAUGCUGACAGCCAGGUAAUGGGUGAGACUGUGGGGUCCCUUUUCCUCUAAAGCCUUUACUCUGAGGAUAAGGUCACAAAGUAGGGUGUGACUUGAAAGUAUCGUGACCAUGUGGCCCACCAGCAGCCUUUCCAAAGGGGAACUCCAGAGACAUUUCAUAAUGCAAACAGCACUGUUGCUUUAAGAACAAGGCCUUUGGAGGUGGCUAAACUUGCACGCACGUGUGUGAAAAGCCAUCCCAUCUUCUGCCUCCAGUUGGAGCUUUCAGCUGUUAAAACAGUCAGAAACUAUUGAUUCUUCCCUUUAGGAAAAAAUGCUCAGGCAGAACGGGGUACAUCCACAGGAGGAAUCGGACGAGAGGAUGUGACAUUCGGUCCAGGAGAGAAAGAGCAGUUUCUGUUAAAGAUGUAACAAAUGGAUUUCCAAAGUCUACAUGACAUUCACUUUUCAAACUUCCCACCAGUUGAAUUUCUUUUUUUCCUUAAGAAACAGGUGAUGUCUUGGAAAACAGCUCCUUAUGUCUCUCUGUGCAUCUCCAUUUUCCUAGUCUCUGGAGUCUCAAAAAGAGUGGCAAAGCACUUUACAGUAGUAACUGAGGAAUCAGAGUCUCUGCUUCAGCGAUAUCUAGUUUGUACAGUUGGGUGAUCUUUUGUAAUUCCUAGGAGGUAAUGCAUUUUUAAUGUUUUCUGAAGCUUUGUAAGUGUGAGAGAGGGACAAGAAGUGCAGUUCUGUUCUGGAAUUCCUUAUUGCUUUCAACGGACACUCUUUGUGAAAAAUCCAAGUAAUAUUUUAGUUCAAACUUGAUCUUGAGCCAAGGCCCACUGCCACCUCUGGGAUGGGAGUCGGACCUACAUACCAAGUGACAAGUUCACCUUAACAUCUGCUUCCAGAAUGGCUUUGAUUCAGCCGUGCCAGGCAACAGAACAGGGUCAGACUCCUGCUCUGUUAUUGGCUUGAAGACUAGGAUCCCAAAGGGGUUGGAGGCAGGGAAUAUUUGAAAAUUCAGACUGGAAUUCCAGGCCAAAAGCUCAAGACCACCAGCCUCUCCUCCUGCCUGGAAAAAUAAGCCUUUGUGAAAGACUGAUUUACCAUGUACAAUUGUGAUUGUGAACGUUGUUGAGUAAACCUCCAGACUUUCUCUAAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 55568)
polypeptide N-acetylgalactosaminyltransferase 10
strand +
GalNAc-T10
NCBI CDS gene sequence (1812 bp)
5'-ATGAGGCGGAAGGAGAAGCGGCTCCTGCAGGCGGTGGCGCTGGTGCTGGCGGCCCTGGTCCTCCTGCCCAACGTGGGGCTTTGGGCGCTGTACCGCGAGCGGCAGCCCGACGGCACCCCTGGGGGATCGGGGGCGGCGGTGGCGCCGGCGGCGGGACAGGGCTCACACAGTCGACAAAAGAAAACGTTTTTCTTGGGAGATGGGCAGAAGCTGAAGGACTGGCATGACAAGGAGGCCATCCGGAGGGACGCTCAGCGCGTAGGAAATGGAGAACAAGGAAGACCTTACCCCATGACCGATGCTGAGAGAGTGGATCAGGCATACCGAGAAAATGGATTTAACATCTACGTCAGTGATAAAATCTCCTTGAATCGCTCTCTCCCAGATATCCGGCACCCAAACTGCAACAGCAAGCGCTACCTGGAGACACTTCCCAACACAAGCATCATCATCCCCTTCCACAACGAGGGCTGGTCCTCCCTCCTCCGCACCGTCCACAGTGTGCTCAATCGCTCGCCTCCAGAGCTGGTCGCCGAGATTGTACTGGTCGACGACTTCAGTGATCGAGAGCACCTGAAGAAGCCTCTTGAAGACTACATGGCCCTTTTCCCCAGTGTGAGGATTCTTCGAACCAAGAAACGGGAAGGGCTGATAAGGACCCGAATGCTGGGGGCCTCAGTGGCAACTGGGGATGTCATCACATTCTTGGATTCACACTGTGAAGCCAATGTCAACTGGCTTCCCCCCTTGCTTGACCGCATTGCTCGGAACCGCAAGACCATTGTGTGCCCGATGATTGATGTAATTGACCATGACGACTTTCGGTACGAGACACAGGCAGGGGATGCCATGCGGGGAGCCTTTGACTGGGAGATGTACTACAAGCGGATCCCGATCCCTCCAGAACTGCAGAAAGCTGACCCCAGCGACCCATTTGAGTCTCCCGTGATGGCCGGTGGACTGTTCGCCGTGGATCGGAAGTGGTTCTGGGAACTCGGCGGGTATGACCCAGGCTTGGAGATCTGGGGAGGGGAGCAGTATGAAATCTCCTTCAAGGTGTGGATGTGTGGGGGCCGCATGGAGGACATCCCCTGCTCCAGGGTGGGCCATATCTACAGGAAGTATGTGCCCTACAAGGTCCCGGCCGGAGTCAGCCTGGCCCGGAACCTTAAGCGGGTGGCCGAAGTGTGGATGGATGAGTACGCAGAGTACATTTACCAGCGCCGGCCTGAATACCGCCACCTCTCCGCTGGGGATGTCGCAGTCCAGAAAAAGCTCCGCAGCTCCCTTAACTGCAAGAGTTTCAAGTGGTTTATGACGAAGATAGCCTGGGACCTGCCCAAATTCTACCCACCCGTGGAGCCCCCGGCTGCAGCTTGGGGGGAGATCCGAAATGTGGGCACAGGGCTGTGTGCAGACACAAAGCACGGGGCCTTGGGCTCCCCACTAAGGCTAGAGGGCTGCGTCCGAGGCCGTGGGGAGGCTGCCTGGAACAACATGCAGGTATTCACCTTCACCTGGAGAGAGGACATCCGGCCTGGAGACCCCCAGCACACCAAGAAGTTCTGCTTTGATGCCATTTCCCACACCAGCCCTGTCACGCTGTACGACTGCCACAGCATGAAGGGCAACCAGCTGTGGAAATACCGCAAAGACAAGACCCTGTACCACCCTGTCAGTGGCAGCTGCATGGACTGCAGTGAAAGTGACCATAGGATCTTCATGAACACCTGCAACCCATCCTCTCTCACCCAGCAGTGGCTGTTTGAACACACCAACTCAACAGTCTTGGAAAAATTCAATAGGAACTGA-3'
NCBI CDS gene sequence with introns (location: 154190867.. 154416972) (226106 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 154190733.. 154420984) (230252 bp)Download
NCBI gene sequence (location: [154190733 - 1000].. 154420984) (231252 bp)Download
Cite How to cite