NCBI Summary
The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM, Apr 2004].
Protein
Protein (NP_443149)
CBM13-ppGalNAc-T13
Polypeptide N-acetylgalactosaminyltransferase 13 (EC 2.4.1.41) (Polypeptide GalNAc transferase 13) (GalNAc-T13) (pp-GaNTase 13) (Protein-UDP acetylgalactosaminyltransferase 13) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13)
GALNT13
polypeptide N-acetylgalactosaminyltransferase 13
Undefined
Curated
Ricin-like
R-Type Lectins
b-trefoil
GalNAc / Mucin-type glycopeptide
0.182
Protein sequence and protein families (fasta) (556 amino acids) Download
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [0.54, 0.92] ÅDownload
The location of the lectin domain structural model is: 428-551
We infer [0.54, 0.92] Å as the interval of error of this structural model.
Template: 1XHB chain: A, O08912, NP_001153876.1, sequence identity: 83.9%, coverage: 100.0%, location in sequence: 95-553, (95-553 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (10 PubMed Identifiers)
  • Revisiting the human polypeptide GalNAc-T1 and T13 paralogs. [27913570]
  • Increased expression levels of ppGalNAc-T13 in lung cancers: Significance in the prognostic diagnosis. [27499036]
  • MicroRNA-424 Predicts a Role for beta-1,4 Branched Glycosylation in Cell Cycle Progression. [26589799]
  • Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism. [24722188]
  • EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children. [24348519]
  • GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease. [21658281]
  • Replication of a genome-wide case-control study of esophageal squamous cell carcinoma. [18649358]
  • Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study. [17903295]
  • A protein interaction framework for human mRNA degradation. [15231747]
  • Cloning and characterization of a new human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, designated pp-GalNAc-T13, that is specifically expressed in neurons and synthesizes GalNAc alpha-serine/threonine antigen. [12407114]
UniProt Main References (4 PubMed Identifiers)
  • Generation and annotation of the DNA sequences of human chromosomes 2 and 4. [15815621]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins. [11572484]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
All isoforms of this gene containing a lectin domain
XP_024308411.1, NP_001363321.1, NP_001363323.1, NP_001363327.1, NP_001363329.1, NP_001363330.1, NP_001363331.1, NP_443149.2, NP_001363334.1, XP_011508840.1, XP_016858751.1, NP_001363332.1, NP_001363333.1, XP_016858748.1, NP_001288556.1
RNA
RNA (Transcript ID: NM_052917.4)
polypeptide N-acetylgalactosaminyltransferase 13, transcript variant 1
m7G-5')ppp(5'-GACCAGGCGGCGGCGGCUCUGCUGAGGUGACAACGUGCUAGCAGCCCUCGCUCGCUCUGGGCGCCUCCUCGGCCUCAGCGUCCGCUCUGGCCGCGCUCGAGGAGCCCUUCAGCCCGCCGCUGCGCUAUGAAGGCCCCUCUCUGGGGCUGGCCGAGGCUGGAGCCGGCUCCCUCUGCUCGCGGGCAAGUGUGAAGAGAGAGGCGCGGGCGGGAGCCGGGGCUGCGCGCGGCGCUCGCGGGCCGGCGCGGGUUCCAGGUGAGCGCGGACUCGGCGAGCCCCGCACUCGGCGCGGCCGGCCGGCGCCUGCUGGGCUUGAUCUGAGGCUGAAUCCCGUGUGUGGACCGCCGUUCCCUCUUCGCGGGAUCGUUGGCCAGGAUAGCAGAUGCAUUUUUGUAGAAGCAUUUUGAGGAUGAAUGUUUGCAAAUCAUUUUGAAAUUGCCAAGUGCCACAUACAUGGAAUGUAUCCUGCUUUCAUCUUGGAGUUCACCUGUGUGGCUUGGAUUUAUCACAGUAGCAUUUGUCUUCAAUCUGUGUGUUAACUAGAAAUCAAGGAAAGACAUGAGGAGAUUUGUCUACUGCAAGGUGGUUCUAGCCACUUCGCUGAUGUGGGUUCUUGUUGAUGUCUUCUUACUGCUGUACUUCAGUGAAUGUAACAAAUGUGAUGACAAGAAGGAGAGAUCUCUGCUGCCUGCAUUGAGGGCUGUUAUUUCAAGAAACCAAGAAGGGCCAGGAGAAAUGGGAAAAGCUGUGUUGAUUCCUAAAGAUGACCAGGAGAAAAUGAAAGAGCUGUUUAAAAUCAAUCAGUUUAACCUUAUGGCCAGUGAUUUGAUUGCCCUUAAUAGAAGUCUGCCAGAUGUAAGAUUAGAAGGAUGUAAGACAAAAGUCUACCCUGAUGAACUUCCAAACACAAGUGUAGUCAUUGUGUUUCAUAAUGAAGCUUGGAGCACUCUCCUUAGAACUGUUUACAGUGUGAUAAAUCGUUCCCCACACUAUCUACUCUCAGAGGUCAUCUUGGUAGAUGAUGCCAGUGAAAGAGAUUUUCUCAAGUUGACAUUAGAGAAUUACGUGAAAAAUUUAGAAGUGCCAGUAAAAAUUAUUAGGAUGGAAGAACGCUCUGGGUUAAUACGUGCCCGUCUUCGAGGAGCAGCUGCUUCAAAAGGGCAGGUCAUAACUUUUCUUGAUGCACACUGUGAAUGCACGUUAGGAUGGCUGGAGCCUUUGCUGGCAAGAAUAAAGGAAGACAGGAAAACGGUUGUCUGCCCUAUCAUUGAUGUGAUUAGUGAUGAUACUUUUGAAUAUAUGGCUGGGUCAGACAUGACUUAUGGGGGUUUUAACUGGAAACUGAAUUUCCGCUGGUAUCCUGUUCCCCAAAGAGAAAUGGACAGGAGGAAAGGAGACAGAACAUUACCUGUCAGGACCCCUACUAUGGCUGGUGGCCUAUUUUCUAUUGACAGAAACUACUUUGAAGAGAUAGGAACUUACGAUGCAGGAAUGGAUAUCUGGGGUGGAGAGAAUCUUGAAAUGUCUUUUAGGAUUUGGCAAUGUGGAGGCUCCUUGGAGAUUGUUACUUGCUCCCAUGUUGGUCAUGUUUUUCGGAAGGCAACUCCAUACACUUUUCCUGGUGGCACUGGUCAUGUCAUCAACAAGAACAACAGGAGACUGGCAGAAGUUUGGAUGGAUGAAUUUAAAGAUUUCUUCUACAUCAUAUCCCCAGGUGUUGUCAAAGUGGAUUAUGGAGAUGUGUCAGUCAGAAAAACACUAAGAGAAAAUCUGAAGUGUAAGCCCUUUUCUUGGUACCUAGAAAACAUCUAUCCGGACUCCCAGAUCCCAAGACGUUAUUACUCACUUGGUGAGAUAAGAAAUGUUGAAACCAAUCAGUGUUUAGACAACAUGGGCCGCAAGGAAAAUGAAAAAGUGGGUAUAUUCAACUGUCAUGGUAUGGGAGGAAAUCAGGUAUUUUCUUACACUGCUGACAAAGAAAUCCGAACCGAUGACUUGUGCUUGGAUGUUUCUAGACUCAAUGGACCUGUAAUCAUGUUAAAAUGCCACCAUAUGAGAGGAAAUCAGUUAUGGGAAUAUGAUGCUGAGAGACUCACGUUGCGACAUGUUAACAGUAACCAAUGUCUCGAUGAACCUUCUGAAGAAGACAAAAUGGUGCCUACAAUGCAGGACUGUAGUGGAAGCAGAUCCCAACAGUGGCUGCUAAGGAACAUGACCUUGGGCACAUGAAGAUCAUGUCCUCCAAGCCAUGAAAGUGUCUACGCUUUUGUUUUUCCAUUAUUUCAAUUGGGGGAAAAUAUUAACUUUGCUGAAUUGAAAGUUUUAAAAAUCCUUUUAGUAUUCUAAAACACAAUUGUUUCUAAUUCGUUUCUAGAAAUGUUUGCUUAUUUCCCUACUAAAAUUUGUAUCUGAUCAAAGCACAUAAGAAUAUAAAUAAUAGCAAACUACUAUUAAACAACAGAACAACUUGUAAAACAAAUUGUGUUUGCUUUAAGAAAAAUGUUUAUUGCACUCAUGUCAUAGGGUUAAUUGGAGGUUAUUUUAUUUUUGGUUGUCAUGGUGAUUGAAAGAGAUAAUGUAAAUGCCUUAUAAAAUCUUCAUUAUGAAAUAUUAUCAGUUGCUUUAUAAACUCACUCUUUUUAUGGAUCCUUCAUGGAAACAUGUUUGAUUUCUGUGUCUACAACAGGGCCACAUAUUAAAUUACUUCUGAAUGGUGAAUUCAUCUUACAAAAUGUUCCAAGUUUUGGACAAGGAAAAACAUUACAUUGGAUAUUGAAUUCAUGGAGCCUUUACAGAAGCAUCACAUUUAAACCAAUGUGAAUUCAAAAAAGAGAAGGAAACUUUUUAAAUUCAAUUUAGAGUACAUAAAAAAAGAAAUCCGCGAAGCAUUGAGGGGAACAAGAUGAGUCUAAUCCGCAGCACUUCGAUCACUGUGAGAGAACUCAAAGUGGGUUGCAAUCAUUCCUAACACAGGCUGAAACUAAACAAUCUUGCUCCUAGAGUUUAUGUUGGAUACUCAAUUCUUAACCAAAAUCUUGGUCUCCACAAACUCUACCAUCCCUUUUCUCUUCACUCUAUAGACAGUGGCAUGCCAUUGAUGCUGUACAGAAUUGCAGGUGAAAGGGAGAAUUUUAGACUUAAUUUUUAACUCUAUUGCACUUAAAGAUUUUAGUUAGGUUACCACUGUCAUUUUCAUUUUCUAUGUUAAAGAAUACCUUUCAGUGCUGUGCUCCAGUAUCUAAAAAUUUUAUCACCAGGGGAAUAAACUCAAUACACAUUCAUUAAACUUUUGUUGUAAUUAAACUGCUAUAUAUUGUUUGCCAUAUAUUAUGGCCCAAGGAAUAUAGUUAUAAUCAGGCUACAUUCACAUUUUCUUUUCUCAUCUUAAAACCCUUUAUGUUCAAAAUACAUUAGCAGAGGCCAUGAAAGUGAAAAAAAAUCAGAUUUUUGCUAGUAAGUUUUUAUAUUUGACAUCAUUUUAAAUGCUCAAAGAGUUGCCCUAUAUAUGCAUGUUAUCCAUUAUAAAUGCACUCAGCAGCUAAGAGAAAUUUGAGAGGAAAAGUGGAAGAAGUGUUUUCUGGAGCAGAAGAUUCCACUUCUUUGGUCCUCAUCUUUACUUAAAAAGCUCUUAUAGAAAGGAUUAAUCAUUUUGACUGCAUACAAACUAUGUCUCUGACAUGCACAUACACUGCUUUAUAAUGAAAAUGAGGACACUUUCUGAUGGUCAGUAAAAUCUUAAAUGAUUUUUGCCACUGGUAUUCCUUCCUCUUUUGACUUUUUAUUGGUACAACUGUAGGGAAGAAUCUACAACCUGGAGCAUUUCAGGUUUGCUCUUUAAAUAUAGACACCCCUCACCAUGAGCUCUCUGUGAAUCCGUGAAUUUCCUAAAAUUGUAAGCAAAAUGUUGAAUAUCAGGGCAUUUUUUUUUCUGAGGUGGGAGUAUGUCACUCACAGCAAACUUGGAAAGAAGGCUAUGACUCCCAAGAGGCAGUGAACCAUUGCCUUAAAUUAAUAGCAGCCUCUCAAGUCCAUUGAGGCCUCAUGUAAAAUUCCCAUUUUUCAUCUUUACACUCCUUUUCUCCCCUCAUUUCCUCUUCUCCUUACUAAGGUAAAAAGACCCUGCACAGCAUUAUUACUUAAGUUGAAAAAGCUUCAACUCUCAAGGACUCAUGUAUACCAUAUGUUCCACUUAUUGCUUUGUUAGUCAAAAUGCAUGUUAUGUAGAAAAUGGUCAAUGGCAAAUUUUUAUAAAUACAGCUACCCCAUCAAAGCUGAACUUGAAACGUUUUAGCAGAAUUUUAAAUAUGUGAAAGUUCAUUGUGGUCAUGGUGAGAAAACUAAAACUACAUGAGUUUCAUGUUAGAAAAGAAUUUUUAAACAAUCUUCAGAUGGCUUGAACACGUGCCAUUAUAGUAUCUAACAAAAAGUGGCAUAAAAUAUUACAAAACAUCCAACACUAGAAAGCAAUGACUAACAUUUAAUUUGUUUACAAAAAUGUUUAUUGUCUUCAGUACAAAAAGUUAAAACCAUGAUUGGAUUCAUAAUGCACUUGUCUUAUCCCUUAUUUAUGGAGCUAGACUGACAUAUUUCAAACCAAUCUCUUCUGUGGUCUUCUCCAUCUCAGUUAAUGCAACUUCAACCUUCCAGAUGCUCAGGUCAAAAACUGAAAGUUGCUUUUGACUCCUCUAUUUCUGUUUCAACUCUCGUCUAAUCCAACAGCAAAUCCCCUUGAUGCUACCUUUGAAAUAUAACUAGAAAAGAAUGACUUGCCACCAUAUCCACUAGGUGUCACUACCUCUAACCUUUUUAAUCGCAAUAUGCUUAUUAUUUAGUUCCCUAAUUUCCCAGUCCUUGUCUUGAACAAUCUUUUCUCAGUACAACAGCCAUAGUGAUUCUGUUAACCAUGAAUUUGAUUGUGUCACUUCCCUGCUCACAAUCUUCCAAUGACUUCUCCCUCCGGUGGCCUUCAAGGUCCUUUAUGAGUGUUACCCCUCUACACGUCCACACCACUCACCACACAUACAUACACAUGCACACACACACACAUGCAAUUCUACCUUUUUCUAACACCAUCUCUUAUCUCUCAUUAUUCUGCCUCUUACUUACCCUAUUAUGGCUCCCAAGAAAGUUCCUGCUUUAGUGUUUUGUUCCCUCUGCCCCAGAGAGCUCCCCUUAGUGAUCUCAGUUCAAAUAUUAUCUUAUCAGUAAGACAAACCCUUCUCCCAUCUGCCUUCCCUAUCCCCUGUACCUGACAAUCUAUGAGUUUGCUUCUUUAUUUCUGUCUAUACUUCCCCCUCCCCAGCCCCAAACAUGCCCAUCACAUGCCCUAGAAGGUAAGUCCCAUGAAGGCAGGGGCUUUGUCAGUUUUGUUCAUUUGGUAUUUCUGGCAUAUAUAUUCUCUAAAUAUUUCUUGAAUUAAUGAACUGAAAAAUGUGUGUUAAAGUUGCUAAGUGUAACUGUAUCAUACUUUUUUUGUAUUUUAAAUUUUAAAAUAAAGGCUAAUAUAUUUAGACAGGAUUUCCAAAAACUUUGUCUUCAAAUUUUAAUUUUCUUCCUAAUAUUCUUCACAUUAAACUAUGGACUCUAAUUUUCUGGAUAAAAUAUCCUGCCUUAUGGAAAUGAAAUAUGAAAUUUUAUUAAAAUGCUGCUAUAUUACA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 114805)
polypeptide N-acetylgalactosaminyltransferase 13
strand +
KIAA1918, GalNAc-T13
NCBI CDS gene sequence (1671 bp)
5'-ATGAGGAGATTTGTCTACTGCAAGGTGGTTCTAGCCACTTCGCTGATGTGGGTTCTTGTTGATGTCTTCTTACTGCTGTACTTCAGTGAATGTAACAAATGTGATGACAAGAAGGAGAGATCTCTGCTGCCTGCATTGAGGGCTGTTATTTCAAGAAACCAAGAAGGGCCAGGAGAAATGGGAAAAGCTGTGTTGATTCCTAAAGATGACCAGGAGAAAATGAAAGAGCTGTTTAAAATCAATCAGTTTAACCTTATGGCCAGTGATTTGATTGCCCTTAATAGAAGTCTGCCAGATGTAAGATTAGAAGGATGTAAGACAAAAGTCTACCCTGATGAACTTCCAAACACAAGTGTAGTCATTGTGTTTCATAATGAAGCTTGGAGCACTCTCCTTAGAACTGTTTACAGTGTGATAAATCGTTCCCCACACTATCTACTCTCAGAGGTCATCTTGGTAGATGATGCCAGTGAAAGAGATTTTCTCAAGTTGACATTAGAGAATTACGTGAAAAATTTAGAAGTGCCAGTAAAAATTATTAGGATGGAAGAACGCTCTGGGTTAATACGTGCCCGTCTTCGAGGAGCAGCTGCTTCAAAAGGGCAGGTCATAACTTTTCTTGATGCACACTGTGAATGCACGTTAGGATGGCTGGAGCCTTTGCTGGCAAGAATAAAGGAAGACAGGAAAACGGTTGTCTGCCCTATCATTGATGTGATTAGTGATGATACTTTTGAATATATGGCTGGGTCAGACATGACTTATGGGGGTTTTAACTGGAAACTGAATTTCCGCTGGTATCCTGTTCCCCAAAGAGAAATGGACAGGAGGAAAGGAGACAGAACATTACCTGTCAGGACCCCTACTATGGCTGGTGGCCTATTTTCTATTGACAGAAACTACTTTGAAGAGATAGGAACTTACGATGCAGGAATGGATATCTGGGGTGGAGAGAATCTTGAAATGTCTTTTAGGATTTGGCAATGTGGAGGCTCCTTGGAGATTGTTACTTGCTCCCATGTTGGTCATGTTTTTCGGAAGGCAACTCCATACACTTTTCCTGGTGGCACTGGTCATGTCATCAACAAGAACAACAGGAGACTGGCAGAAGTTTGGATGGATGAATTTAAAGATTTCTTCTACATCATATCCCCAGGTGTTGTCAAAGTGGATTATGGAGATGTGTCAGTCAGAAAAACACTAAGAGAAAATCTGAAGTGTAAGCCCTTTTCTTGGTACCTAGAAAACATCTATCCGGACTCCCAGATCCCAAGACGTTATTACTCACTTGGTGAGATAAGAAATGTTGAAACCAATCAGTGTTTAGACAACATGGGCCGCAAGGAAAATGAAAAAGTGGGTATATTCAACTGTCATGGTATGGGAGGAAATCAGGTATTTTCTTACACTGCTGACAAAGAAATCCGAACCGATGACTTGTGCTTGGATGTTTCTAGACTCAATGGACCTGTAATCATGTTAAAATGCCACCATATGAGAGGAAATCAGTTATGGGAATATGATGCTGAGAGACTCACGTTGCGACATGTTAACAGTAACCAATGTCTCGATGAACCTTCTGAAGAAGACAAAATGGTGCCTACAATGCAGGACTGTAGTGGAAGCAGATCCCAACAGTGGCTGCTAAGGAACATGACCTTGGGCACATGA-3'
NCBI CDS gene sequence with introns (location: 153944498.. 154450551) (506054 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 153871922.. 154453979) (582058 bp)Download
NCBI gene sequence (location: [153871922 - 1000].. 154453979) (583058 bp)Download
Cite How to cite