NCBI Summary
This gene encodes a protein belonging to the L-type lectin group of type 1 membrane proteins, which function in the mammalian early secretory pathway. These proteins contain luminal carbohydrate recognition domains, which display homology to leguminous lectins. Unlike other proteins of the group, which cycle in the early secretory pathway and are predominantly associated with post endoplasmic reticulum membranes, the protein encoded by this gene is a non-cycling resident protein of the ER, where it functions as a cargo receptor for glycoproteins. It is proposed to regulate exchange of folded proteins for transport to the Golgi and exchange of misfolded glycoproteins for transport to the ubiquitin-proteasome pathway. [provided by RefSeq, Apr 2016].
Protein
Protein (NP_110432)
VIPL - lectin, mannose binding 2
VIP36-like protein (Lectin mannose-binding 2-like) (LMAN2-like protein)
LMAN2L
lectin, mannose binding 2 like
Undefined
Curated
ERGIC-VIP L-type
L-Type Lectins
b-sandwich / ConA-like
Man / Man(a1-2)Man / High mannose N-glycan
0.551
Protein sequence and protein families (fasta) (348 amino acids) Download
MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
No structure currently available in the PDB RCSB Databank.
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.


SWISS-MODEL structural models
Modeller structural model (Homology modelling pipeline), Error: [0.96, 1.21] ÅDownload
The location of the lectin domain structural model is: 49-275
We infer [0.96, 1.21] Å as the interval of error of this structural model.
Template 1: 2DUR chain: A, P49256, NP_001003258.1, sequence identity: 65.2%, coverage: 99.6%, location in sequence: 51-301, (51-301 in PDB).
Template 2: 1R1Z chain: A, Q62902, NP_446338.1, sequence identity: 33.9%, coverage: 97.8%, location in sequence: 28-277, (28-277 in PDB).
Template 3: 4GKY chain: A, P49257, NP_005561.1, sequence identity: 33.5%, coverage: 97.8%, location in sequence: 41-269, (41-269 in PDB).
Show the alignment used for the construction of the structural model, Download.
Show the plot of DOPE energy score, Download.
Ligand
Glycan ligands from structural data
No crystal structures of complexes with glycan ligand.
References
NCBI References (8 PubMed Identifiers)
  • Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. [32814053]
  • A reference map of the human binary protein interactome. [32296183]
  • Dominant LMAN2L mutation causes intellectual disability with remitting epilepsy. [31020005]
  • Homozygous missense mutation in the LMAN2L gene segregates with intellectual disability in a large consanguineous Pakistani family. [26566883]
  • Genetic association of LMAN2L gene in schizophrenia and bipolar disorder and its interaction with ANK3 gene polymorphism. [24914473]
  • Molecular basis of sugar recognition by the human L-type lectins ERGIC-53, VIPL, and VIP36. [18025080]
  • VIPL, a VIP36-like membrane protein with a putative function in the export of glycoproteins from the endoplasmic reticulum. [12878160]
  • Profile-based data base scanning for animal L-type lectins and characterization of VIPL, a novel VIP36-like endoplasmic reticulum protein. [12609988]
UniProt Main References (9 PubMed Identifiers)
  • Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. [11230166]
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. [16303743]
  • The full-ORF clone resource of the German cDNA Consortium. [17974005]
  • Generation and annotation of the DNA sequences of human chromosomes 2 and 4. [15815621]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • Initial characterization of the human central proteome. [21269460]
  • N-terminome analysis of the human mitochondrial proteome. [25944712]
All isoforms of this gene containing a lectin domain
NP_110432.1, NP_001135764.1, NP_001309279.1, XP_024308935.1, NP_001309276.1, NP_001309281.1, NP_001309280.1, NP_001309284.1, NP_001309285.1, NP_001309275.1, NP_001309283.1
RNA
RNA (Transcript ID: NM_030805.4)
lectin, mannose binding 2 like, transcript variant 2
m7G-5')ppp(5'-GAUGAAGGGUCGUUGGUGGGAAAGAUGGCGGCGACUCUGGGACCCCUUGGGUCGUGGCAGCAGUGGCGGCGAUGUUUGUCGGCUCGGGAUGGGUCCAGGAUGUUACUCCUUCUUCUUUUGUUGGGGUCUGGGCAGGGGCCACAGCAAGUCGGGGCGGGUCAAACGUUCGAGUACUUGAAACGGGAGCACUCGCUGUCGAAGCCCUACCAGGGUGUGGGCACAGGCAGUUCCUCACUGUGGAAUCUGAUGGGCAAUGCCAUGGUGAUGACCCAGUAUAUCCGCCUUACCCCAGAUAUGCAAAGUAAACAGGGUGCCUUGUGGAACCGGGUGCCAUGUUUCCUGAGAGACUGGGAGUUGCAGGUGCACUUCAAAAUCCAUGGACAAGGAAAGAAGAAUCUGCAUGGGGAUGGCUUGGCAAUCUGGUACACAAAGGAUCGGAUGCAGCCAGGGCCUGUGUUUGGAAACAUGGACAAAUUUGUGGGGCUGGGAGUAUUUGUAGACACCUACCCCAAUGAGGAGAAGCAGCAAGAGCGGGUAUUCCCCUACAUCUCAGCCAUGGUGAACAACGGCUCCCUCAGCUAUGAUCAUGAGCGGGAUGGGCGGCCUACAGAGCUGGGAGGCUGCACAGCCAUUGUCCGCAAUCUUCAUUACGACACCUUCCUGGUGAUUCGCUACGUCAAGAGGCAUUUGACGAUAAUGAUGGAUAUUGAUGGCAAGCAUGAGUGGAGGGACUGCAUUGAAGUGCCCGGAGUCCGCCUGCCCCGCGGCUACUACUUCGGCACCUCCUCCAUCACUGGGGAUCUCUCAGAUAAUCAUGAUGUCAUUUCCUUGAAGUUGUUUGAACUGACAGUGGAGAGAACCCCAGAAGAGGAAAAGCUCCAUCGAGAUGUGUUCUUGCCCUCAGUGGACAAUAUGAAGCUGCCUGAGAUGACAGCUCCACUGCCGCCCCUGAGUGGCCUGGCCCUCUUCCUCAUCGUCUUUUUCUCCCUGGUGUUUUCUGUAUUUGCCAUAGUCAUUGGUAUCAUACUCUACAACAAAUGGCAGGAACAGAGCCGAAAGCGCUUCUACUGAGCCCUCCUGCUGCCACCACUUUUGUGACUGUCACCCAUGAGGUAUGGAAGGAGCAGGCACUGGCCUGAGCAUGCAGCCUGGAGAGUGUUCUUGUCUCUAGCAGCUGGUUGGGGACUAUAUUCUGUCACUGGAGUUUUGAAUGCAGGGACCCCGCAUUCCCAUGGUUGUGCAUGGGGACAUCUAACUCUGGUCUGGGAAGCCACCCACCCCAGGGCAAUGCUGCUGUGAUGUGCCUUUCCCUGCAGUCCUUCCAUGUGGGAGCAGAGGUGUGAAGAGAAUUUACGUGGUUGUGAUGCCAAAAUCACAGAACAGAAUUUCAUAGCCCAGGCUGCCGUGUUGUUUGACUCAGAAGGCCCUUCUACUUCAGUUUUGAAUCCACAAAGAAUUAAAAACUGGUAACACCACAGGCUUUCUGACCAUCCAUUCGUUGGGUUUUGCAUUUGACCCAACCCUCUGCCUACCUGAGGAGCUUUCUUUGGAAACCAGGAUGGAAACUUCUUCCCUGCCUUACCUUCCUUUCACUCCAUUCAUUGUCCUCUCUGUGUGCAACCUGAGCUGGGAAAGGCAUUUGGAUGCCUCUCUGUUGGGGCCUGGGGCUGCAGAACACACCUGCGUUUCACUGGCCUUCAUUAGGUGGCCCUAGGGAGAUGGCUUUCUGCUUUGGAUCACUGUUCCCUAGCAUGGGUCUUGGGUCUAUUGGCAUGUCCAUGGCCUUCCCAAUCAAGUCUCUUCAGGCCCUCAGUGAAGUUUGGCUAAAGGUUGGUGUAAAAAUCAAGAGAAGCCUGGAAGACAUCAUGGAUGCCAUGGAUUAGCUGUGCAACUGACCAGCUCCAGGUUUGAUCAAACCAAAAGCAACAUUUGUCAUGUGGUCUGACCAUGUGGAGAUGUUUCUGGACUUGCUAGAGCCUGCUUAGCUGCAUGUUUUGUAGUUACGAUUUUUGGAAUCCCACUUUGAGUGCUGAAAGUGUAAGGAAGCUUUCUUCUUACACCUUGGGCUUGGAUAUUGCCCAGAGAAGAAAUUUGGCUUUUUUUUUCUUAAUGGACAAGAGACAGUUGCUGUUCUCAUGUUCCAAGUCUGAGAGCAACAGACCCUCAUCAUCUGUGCCUGGAAGAGUUCACUGUCAUUGAGCAGCACAGCCUGAGUGCUGGCCUCUGUCAACCCUUAUUCCACUGCCUUAUUUGACAAGGGGUUACAUGCUGCUCACCUUACUGCCCUGGGAUUAAAUCAGUUACAGGCCAGAGUCUCCUUGGAGGGCCUGGAACUCUGAGUCCUCCUAUGAACCUCUGUAGCCUAAAUGAAAUUCUUAAAAUCACCGAUGGAACCAAA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 81562)
lectin, mannose binding 2 like
strand -
DKFZp564L2423, VIPL
NCBI CDS gene sequence (1047 bp)
5'-ATGGCGGCGACTCTGGGACCCCTTGGGTCGTGGCAGCAGTGGCGGCGATGTTTGTCGGCTCGGGATGGGTCCAGGATGTTACTCCTTCTTCTTTTGTTGGGGTCTGGGCAGGGGCCACAGCAAGTCGGGGCGGGTCAAACGTTCGAGTACTTGAAACGGGAGCACTCGCTGTCGAAGCCCTACCAGGGTGTGGGCACAGGCAGTTCCTCACTGTGGAATCTGATGGGCAATGCCATGGTGATGACCCAGTATATCCGCCTTACCCCAGATATGCAAAGTAAACAGGGTGCCTTGTGGAACCGGGTGCCATGTTTCCTGAGAGACTGGGAGTTGCAGGTGCACTTCAAAATCCATGGACAAGGAAAGAAGAATCTGCATGGGGATGGCTTGGCAATCTGGTACACAAAGGATCGGATGCAGCCAGGGCCTGTGTTTGGAAACATGGACAAATTTGTGGGGCTGGGAGTATTTGTAGACACCTACCCCAATGAGGAGAAGCAGCAAGAGCGGGTATTCCCCTACATCTCAGCCATGGTGAACAACGGCTCCCTCAGCTATGATCATGAGCGGGATGGGCGGCCTACAGAGCTGGGAGGCTGCACAGCCATTGTCCGCAATCTTCATTACGACACCTTCCTGGTGATTCGCTACGTCAAGAGGCATTTGACGATAATGATGGATATTGATGGCAAGCATGAGTGGAGGGACTGCATTGAAGTGCCCGGAGTCCGCCTGCCCCGCGGCTACTACTTCGGCACCTCCTCCATCACTGGGGATCTCTCAGATAATCATGATGTCATTTCCTTGAAGTTGTTTGAACTGACAGTGGAGAGAACCCCAGAAGAGGAAAAGCTCCATCGAGATGTGTTCTTGCCCTCAGTGGACAATATGAAGCTGCCTGAGATGACAGCTCCACTGCCGCCCCTGAGTGGCCTGGCCCTCTTCCTCATCGTCTTTTTCTCCCTGGTGTTTTCTGTATTTGCCATAGTCATTGGTATCATACTCTACAACAAATGGCAGGAACAGAGCCGAAAGCGCTTCTACTGA-3'
NCBI CDS gene sequence with introns (location: 96707256.. 96740040) (32785 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 96705929.. 96740064) (34136 bp)Download
NCBI gene sequence (location: [96705929.. 96740064 + 1000]) (35136 bp)Download
How to cite: Schnider B., M'Rad Y., el Ahmadie J., de Brevern AG., Imberty A., Lisacek F., HumanLectome, an update of UniLectin for the annotation and prediction of human lectins, Nucleic Acids Reasearch doi.org/10.1093/nar/gkad905