NCBI Summary
This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011].
Protein
Protein (NP_076932)
Collectin-K1
Collectin-11 (Collectin kidney protein 1) (CL-K1)
COLEC11
collectin subfamily member 11
Undefined
Curated
C-type lectin
COLEC11
C-type - Collectins
a/b mixed / C-type lectin-like
0.383
Protein sequence and protein families (fasta) (271 amino acids) Download
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Mol* PDB structure viewerUniLectin3D
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Ligand
Glycan ligands from structural data
aMan12Man
Man(a1-2)Man
References
NCBI References (10 PubMed Identifiers)
  • Association of Polymorphisms of MASP1/3, COLEC10, and COLEC11 Genes with 3MC Syndrome. [32751929]
  • C1q/TNF-Related Protein 6 Is a Pattern Recognition Molecule That Recruits Collectin-11 from the Complement System to Ligands. [32041782]
  • Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. [32045104]
  • Human collectin-11 (COLEC11) and its synergic genetic interaction with MASP2 are associated with the pathophysiology of Chagas Disease. [30995222]
  • Collectin-11/MASP complex formation triggers activation of the lectin complement pathway--the fifth lectin pathway initiation complex. [23220946]
  • Comparison of human blood concentrations of collectin kidney 1 and mannan-binding lectin. [21893516]
  • Disease-causing mutations in genes of the complement system. [21664996]
  • Mutations in lectin complement pathway genes COLEC11 and MASP1 cause 3MC syndrome. [21258343]
  • Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. [20956340]
  • Identification and characterization of a novel human collectin CL-K1. [17179669]
UniProt Main References (10 PubMed Identifiers)
  • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. [12975309]
  • Complete sequencing and characterization of 21,243 full-length human cDNAs. [14702039]
  • Generation and annotation of the DNA sequences of human chromosomes 2 and 4. [15815621]
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
  • The full-ORF clone resource of the German cDNA Consortium. [17974005]
  • A quantitative atlas of mitotic phosphorylation. [18669648]
  • Characterization of the interaction between collectin 11 (CL-11, CL-K1) and nucleic acids. [23954398]
  • An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. [24275569]
  • Molecular basis of sugar recognition by collectin-K1 and the effects of mutations associated with 3MC syndrome. [25912189]
  • COLEC10 is mutated in 3MC patients and regulates early craniofacial development. [28301481]
All isoforms of this gene containing a lectin domain
NP_001242918.1, NP_001242916.1, NP_001242917.1, NP_001242913.1, NP_001242915.1, NP_001242911.1, NP_001242912.1, NP_954705.1, XP_005263910.1, XP_006711960.1, NP_076932.1, NP_001242914.1
RNA
RNA (Transcript ID: NM_024027.5)
collectin subfamily member 11, transcript variant 1
m7G-5')ppp(5'-AGUGUCCUCGCGGGCCAGCGACGGGCAGGACGCCCCGUUCGCCUAGCGCGUGCUCAGGAGUUGGUGUCCUGCCUGCGCUCAGGAUGAGGGGGAAUCUGGCCCUGGUGGGCGUUCUAAUCAGCCUGGCCUUCCUGUCACUGCUGCCAUCUGGACAUCCUCAGCCGGCUGGCGAUGACGCCUGCUCUGUGCAGAUCCUCGUCCCUGGCCUCAAAGGGGAUGCGGGAGAGAAGGGAGACAAAGGCGCCCCCGGACGGCCUGGAAGAGUCGGCCCCACGGGAGAAAAAGGAGACAUGGGGGACAAAGGACAGAAAGGCAGUGUGGGUCGUCAUGGAAAAAUUGGUCCCAUUGGCUCUAAAGGUGAGAAAGGAGAUUCCGGUGACAUAGGACCCCCUGGUCCUAAUGGAGAACCAGGCCUCCCAUGUGAGUGCAGCCAGCUGCGCAAGGCCAUCGGGGAGAUGGACAACCAGGUCUCUCAGCUGACCAGCGAGCUCAAGUUCAUCAAGAAUGCUGUCGCCGGUGUGCGCGAGACGGAGAGCAAGAUCUACCUGCUGGUGAAGGAGGAGAAGCGCUACGCGGACGCCCAGCUGUCCUGCCAGGGCCGCGGGGGCACGCUGAGCAUGCCCAAGGACGAGGCUGCCAAUGGCCUGAUGGCCGCAUACCUGGCGCAAGCCGGCCUGGCCCGUGUCUUCAUCGGCAUCAACGACCUGGAGAAGGAGGGCGCCUUCGUGUACUCUGACCACUCCCCCAUGCGGACCUUCAACAAGUGGCGCAGCGGUGAGCCCAACAAUGCCUACGACGAGGAGGACUGCGUGGAGAUGGUGGCCUCGGGCGGCUGGAACGACGUGGCCUGCCACACCACCAUGUACUUCAUGUGUGAGUUUGACAAGGAGAACAUGUGAGCCUCAGGCUGGGGCUGCCCAUUGGGGGCCCCACAUGUCCCUGCAGGGUUGGCAGGGACAGAGCCCAGACCAUGGUGCCAGCCAGGGAGCUGUCCCUCUGUGAAGGGUGGAGGCUCACUGAGUAGAGGGCUGUUGUCUAAACUGAGAAAAUGGCCUAUGCUUAAGAGGAAAAUGAAAGUGUUCCUGGGGUGCUGUCUCUGAAGAAGCAGAGUUUCAUUACCUGUAUUGUAGCCCCAAUGUCAUUAUGUAAUUAUUACCCAGAAUUGCUCUUCCAUAAAGCUUGUGCCUUUGUCCAAGCUAUACAAUAAAAUCUUUAAGUAGUGCAGUAGUUAAGUCCAAAUAGUGGCAAUGGGGUCUUGAAUUACUACCUUUUAAUUUCUAUAUGGAAAAGAACUCACUUUGACCAACACUUCUGUAAAUUACAUUACAAUAUAGGUUCCUUCACACUAUUAUCCAUGUAAAAACAAUUUUGCUUUGCUUCAAACCCAGAUUUCAGGAAAACAACAACAAAAUUCUCCAAACUUUA-3'- Poly-A tail
  • Coding region
;
DNA
DNA (Gene ID: 78989)
collectin subfamily member 11
strand +
MGC3279, CL-K1, CL-11
NCBI CDS gene sequence (816 bp)
5'-ATGAGGGGGAATCTGGCCCTGGTGGGCGTTCTAATCAGCCTGGCCTTCCTGTCACTGCTGCCATCTGGACATCCTCAGCCGGCTGGCGATGACGCCTGCTCTGTGCAGATCCTCGTCCCTGGCCTCAAAGGGGATGCGGGAGAGAAGGGAGACAAAGGCGCCCCCGGACGGCCTGGAAGAGTCGGCCCCACGGGAGAAAAAGGAGACATGGGGGACAAAGGACAGAAAGGCAGTGTGGGTCGTCATGGAAAAATTGGTCCCATTGGCTCTAAAGGTGAGAAAGGAGATTCCGGTGACATAGGACCCCCTGGTCCTAATGGAGAACCAGGCCTCCCATGTGAGTGCAGCCAGCTGCGCAAGGCCATCGGGGAGATGGACAACCAGGTCTCTCAGCTGACCAGCGAGCTCAAGTTCATCAAGAATGCTGTCGCCGGTGTGCGCGAGACGGAGAGCAAGATCTACCTGCTGGTGAAGGAGGAGAAGCGCTACGCGGACGCCCAGCTGTCCTGCCAGGGCCGCGGGGGCACGCTGAGCATGCCCAAGGACGAGGCTGCCAATGGCCTGATGGCCGCATACCTGGCGCAAGCCGGCCTGGCCCGTGTCTTCATCGGCATCAACGACCTGGAGAAGGAGGGCGCCTTCGTGTACTCTGACCACTCCCCCATGCGGACCTTCAACAAGTGGCGCAGCGGTGAGCCCAACAATGCCTACGACGAGGAGGACTGCGTGGAGATGGTGGCCTCGGGCGGCTGGAACGACGTGGCCTGCCACACCACCATGTACTTCATGTGTGAGTTTGACAAGGAGAACATGTGA-3'
NCBI CDS gene sequence with introns (location: 3604341.. 3644118) (39778 bp)Download
NCBI CDS gene sequence with introns, 5'UTR and 3'UTR (location: 3595112.. 3644644) (49533 bp)Download
NCBI gene sequence (location: [3595112 - 1000].. 3644644) (50533 bp)Download
Cite How to cite