NCBI Summary
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008].
Protein
Protein (NP_001035972)
Galectin 7
Galectin-7 (Gal-7) (HKL-14) (PI7) (p53-induced gene 1 protein)
LGALS7B
galectin 7B
Undefined
Curated
galectin-like
S-Type Lectins - Prototypical
b-sandwich / ConA-like
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Mol* PDB structure viewerUniLectin3D
Structural models
Ligand
Glycan ligands from structural data
References
NCBI References (10 PubMed Identifiers)
- Structural Characterization of N-Linked Glycans in the Receptor Binding Domain of the SARS-CoV-2 Spike Protein and their Interactions with Human Lectins. [32915505]
- A reference map of the human binary protein interactome. [32296183]
- Galectin-7 serum levels are altered prior to the onset of pre-eclampsia. [24534543]
- Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT). [19199708]
- Increased expression and altered intracellular distribution of adhesion/growth-regulatory lectins galectins-1 and -7 during tumour progression in hypopharyngeal and laryngeal squamous cell carcinomas. [18315601]
- Homodimeric galectin-7 (p53-induced gene 1) is a negative growth regulator for human neuroblastoma cells. [13679866]
- Galectin-7 (PIG1) exhibits pro-apoptotic function through JNK activation and mitochondrial cytochrome c release. [11706006]
- Structural basis for the recognition of carbohydrates by human galectin-7. [9760227]
- Galectin-7, a human 14-kDa S-lectin, specifically expressed in keratinocytes and sensitive to retinoic acid. [7729568]
- Cloning, expression, and chromosome mapping of human galectin-7. [7534301]
UniProt Main References (1 PubMed Identifiers)
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [15489334]
RNA
RNA (Transcript ID: NM_001042507.4)
m7G-5')ppp(5'-CCACGGCUGCCCAACCCGGUCCCAGCCAUGUCCAACGUCCCCCACAAGUCCUCACUGCCCGAGGGCAUCCGCCCUGGCACGGUGCUGAGAAUUCGCGGCUUGGUUCCUCCCAAUGCCAGCAGGUUCCAUGUAAACCUGCUGUGCGGGGAGGAGCAGGGCUCCGAUGCCGCCCUGCAUUUCAACCCCCGGCUGGACACGUCGGAGGUGGUCUUCAACAGCAAGGAGCAAGGCUCCUGGGGCCGCGAGGAGCGCGGGCCGGGCGUUCCUUUCCAGCGCGGGCAGCCCUUCGAGGUGCUCAUCAUCGCGUCAGACGACGGCUUCAAGGCCGUGGUUGGGGACGCCCAGUACCACCACUUCCGCCACCGCCUGCCGCUGGCGCGCGUGCGCCUGGUGGAGGUGGGCGGGGACGUGCAGCUGGACUCCGUGAGGAUCUUCUGAGCAGAAGCCCAGGCGGGCCCGGGGCCUUGGCUGGCAAAUAAAGCGUUAGCCCGCAGCGCGA-3'- Poly-A tail
- Coding region
DNA
DNA (Gene ID: 653499)
galectin 7B
strand +
NCBI CDS gene sequence (411 bp)
5'-ATGTCCAACGTCCCCCACAAGTCCTCACTGCCCGAGGGCATCCGCCCTGGCACGGTGCTGAGAATTCGCGGCTTGGTTCCTCCCAATGCCAGCAGGTTCCATGTAAACCTGCTGTGCGGGGAGGAGCAGGGCTCCGATGCCGCCCTGCATTTCAACCCCCGGCTGGACACGTCGGAGGTGGTCTTCAACAGCAAGGAGCAAGGCTCCTGGGGCCGCGAGGAGCGCGGGCCGGGCGTTCCTTTCCAGCGCGGGCAGCCCTTCGAGGTGCTCATCATCGCGTCAGACGACGGCTTCAAGGCCGTGGTTGGGGACGCCCAGTACCACCACTTCCGCCACCGCCTGCCGCTGGCGCGCGTGCGCCTGGTGGAGGTGGGCGGGGACGTGCAGCTGGACTCCGTGAGGATCTTCTGA-3'
By using this site you agree to our privacy policy.
Please confirm you agree with the privacy policy before using the site.