P13591 identified as I-type lectin in LectomeXplore
P13591
Redundant proteins identified: BAF85142.1 AAH47244.1 KAI2562835.1 
Structural models
AlphaFold v2: AF-P13591-F1Download
  Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene-related data
View sequence for I-type lectin 64 : 99View sequence for I-type lectin 128 : 191View sequence for I-type lectin 324 : 398View sequence for I-type lectin 418 : 453View gene sequenceView neighboring sequences
REFERENCE: SAAEGECVEIPCSFSYPDDESDPVHVSWYRKEEGKEDVTSKRDREVHEETQGRFRLLGDPREKNCSLSISNLRKEDSGTYFC-V
PREDICTED: EFREGEDAVIVCDVVSSL----PPTIIWKHKGR-----------DVILKKDVRFIVLS-----NNYLQIRGIKKTDEGTYRCEG
Cite How to cite