P07204 identified as C-type lectin in LectomeXplore
P07204
Redundant proteins identified: 
Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
REFERENCE: KWKAFQGKCYFFSNEKKTWEEAEKACSERGAHLVVIKSAEEQEFLQ-----QLSKSNSY-WIGLT------DEKTEGT---WQWVDGSPLNY-KNWAPGEPNNAGN--EDCV-------EIKANG--WNDVKCEKK-KLAICEKEA
PREDICTED: GSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPS-EPIWEEQQCEVKADGFLCEFHF
Cite How to cite