Q9UQP3 identified as Ficolin-like in LectomeXplore
Q9UQP3
Redundant proteins identified: B3KXB6 KAI2520502.1 KAI4084024.1 
Structural models
Model Confidence:
  •    Very high (pLDDT > 90)
  •    Confident (90 > pLDDT > 70)
  •    Low (70 > pLDDT > 50)
  •    Very low (pLDDT < 50)

  AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Some regions with low pLDDT may be unstructured in isolation.

Amino acid conservation

Reference conserved motif. Graphics generated by Skylign
Gene viewer
View sequence for Ficolin-like 1066 : 1276View gene sequenceView neighboring sequences
REFERENCE: SPRSCKDLLDEGSALSGLYTLL---PDGRALQVFCDMDTDGGGWTVVQRRQDGSVDFYREWANYKQ-FGSAEGEFWLGNDKIHALTAQ--GSSELRVDLVDFEGNNQFAKYKSFKVKDEEEKYKLDLGAFVGSAGDSLSLHSNKQFSTKDKDRDASESNCAVKVKGAWWYKNCHESN--GLYLEGSHESYADGIDWSSAKGYSYSKKVSEMKVRP
PREDICTED: HPSDCSQVQQNSNAASGLYTIYLHGDASRPLQVYCDMETDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTPARYEVRVDLQT-ANESAYAIYDFFQVASSKERYKLTVGKYRGTAGDALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKH---SEGVNWEPWKGHEFSIPYVELKIRP
Cite How to cite